Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (CHO, C103S)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (CHO, C103S) is the recombinant human-derived IgG1 protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (CHO, C103S), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg1-protein-human-cho.html

Purity

97.00

Smiles

EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (E99-K330, C103S) (Accession)

Molecular Weight

Approximately 29-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLINT1 Mouse Monoclonal Antibody [Clone ID: OTI6G10]
TA805982 100 µL

CLINT1 Mouse Monoclonal Antibody [Clone ID: OTI6G10]

Sign In for Pricing
View Details
Keratin 19 Colorimetric Cell-Based ELISA Kit
MBS9500341-01 1 Kit

Keratin 19 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Keratin 19 Colorimetric Cell-Based ELISA Kit
MBS9500341-02 5x 1 Kit

Keratin 19 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
MRPS18C
CSB-CL897484HU 10 μg Plasmid + 200 μL Glycerol

MRPS18C

Sign In for Pricing
View Details
Lentiviral mouse Rnf10 shRNA (UAS) - Lentiviral mouse Rnf10 shRNA (UAS, RFP) (100)
GTR15263004 1 Vial

Lentiviral mouse Rnf10 shRNA (UAS) - Lentiviral mouse Rnf10 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PKC zeta antibody (Thr410)
70R-30598 0.1 mg

PKC zeta antibody (Thr410)

Sign In for Pricing
View Details