Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG1, Human (CHO, C103S)

The IgG1 protein is the constant region of the immunoglobulin heavy chain and serves as a receptor during the recognition phase of humoral immunity. It triggers clonal expansion and differentiation of B lymphocytes into immunoglobulin-secreting plasma cells. IgG1 Protein, Human (CHO, C103S) is the recombinant human-derived IgG1 protein, expressed by CHO , with tag free.

Product Specifications

Product Name Alternative

IgG1 Protein, Human (CHO, C103S), Human, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg1-protein-human-cho.html

Purity

97.00

Smiles

EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Formula

3500 (Gene_ID) P01857-1 (E99-K330, C103S) (Accession)

Molecular Weight

Approximately 29-35 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR84 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0893507 1.0 µg DNA

GPR84 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TGM3 AAV Vector (Mouse) (CMV)
46612104 1 µg

TGM3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid
OR302704-01 250 mg

(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid

Sign In for Pricing
View Details
(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid
OR302704-02 1 g

(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid

Sign In for Pricing
View Details
(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid
OR302704-03 5 g

(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid

Sign In for Pricing
View Details
(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid
OR302704-04 25 g

(S) -2- (1- (tert-Butoxycarbonyl) pyrrolidin-2-yl) acetic acid

Sign In for Pricing
View Details