Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clumping factor A, S. aureus

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Clumping factor A Protein, S. aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus.html

Purity

97.00

Smiles

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Formula

/ (Gene_ID) Q6GB45 (G228-E558) (Accession)

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit
MBS9900091-01 48 Well

Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit

Ask
View Details
Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit
MBS9900091-02 96 Well

Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit

Ask
View Details
Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit
MBS9900091-03 5x 96 Well

Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit

Ask
View Details
Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit
MBS9900091-04 10x 96 Well

Camel Dynein Assembly Factor 1, Axonemal (LRRC50) ELISA Kit

Ask
View Details
PHLDA2 polyclonal antibody
BS7988-01 50 µL

PHLDA2 polyclonal antibody

Ask
View Details
PHLDA2 polyclonal antibody
BS7988-02 100 µL

PHLDA2 polyclonal antibody

Ask
View Details