Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clumping factor A, S. aureus

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Clumping factor A Protein, S. aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus.html

Purity

97.00

Smiles

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Formula

/ (Gene_ID) Q6GB45 (G228-E558) (Accession)

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OCIL (C-type Lectin Domain Family 2 Member D, Lectin-like NK Cell Receptor, Lectin-like Transcript 1, LLT-1, Osteoclast Inhibitory Lectin, CLAX, LLT1, CLEC2D) discontinued
O8061-01A 50 µg

OCIL (C-type Lectin Domain Family 2 Member D, Lectin-like NK Cell Receptor, Lectin-like Transcript 1, LLT-1, Osteoclast Inhibitory Lectin, CLAX, LLT1, CLEC2D) discontinued

Sign In for Pricing
View Details
Vitronectin (VTN) (NM_000638) Human Tagged Lenti ORF Clone
RC202929L2 10 µg

Vitronectin (VTN) (NM_000638) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal POLR2C Antibody
NBP2-19885 0.1 mL

Rabbit Polyclonal POLR2C Antibody

Sign In for Pricing
View Details
Akr1c13 (NM_001014240) Rat Tagged Lenti ORF Clone
RR209874L3 10 µg

Akr1c13 (NM_001014240) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LIN28A Antibody, Biotin conjugated
CSB-PA13619D0Rb-01 50 µg

LIN28A Antibody, Biotin conjugated

Sign In for Pricing
View Details
LIN28A Antibody, Biotin conjugated
CSB-PA13619D0Rb-02 100 µg

LIN28A Antibody, Biotin conjugated

Sign In for Pricing
View Details