Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clumping factor A, S. aureus

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Clumping factor A Protein, S. aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus.html

Purity

97.00

Smiles

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Formula

/ (Gene_ID) Q6GB45 (G228-E558) (Accession)

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Rabbit Polyclonal Antibody (BF647)
orb2427889 100 µL

APC Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
SCN-05-2 ClipSleeve Markers
133052 300 Pack (30 Sleeve (s) x 10 Wand)

SCN-05-2 ClipSleeve Markers

Sign In for Pricing
View Details
Human CD25/IL-2sR Alpha ELISA Kit
orb1658302 96 Tests

Human CD25/IL-2sR Alpha ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Amphoterin-induced protein 2 Protein
ARP1148-01 10 µg

Recombinant Human Amphoterin-induced protein 2 Protein

Sign In for Pricing
View Details
Recombinant Human Amphoterin-induced protein 2 Protein
ARP1148-02 50 µg

Recombinant Human Amphoterin-induced protein 2 Protein

Sign In for Pricing
View Details
Recombinant Human Amphoterin-induced protein 2 Protein
ARP1148-03 100 µg

Recombinant Human Amphoterin-induced protein 2 Protein

Sign In for Pricing
View Details