Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clumping factor A, S. aureus

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Clumping factor A Protein, S. aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus.html

Purity

97.00

Smiles

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Formula

/ (Gene_ID) Q6GB45 (G228-E558) (Accession)

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DCC-interacting Protein 13-alpha
MBS398075-01 0.1 mg

DCC-interacting Protein 13-alpha

Ask
View Details
DCC-interacting Protein 13-alpha
MBS398075-02 5x 0.1 mg

DCC-interacting Protein 13-alpha

Ask
View Details
Lentiviral mouse Oas1b shRNA (UAS) - Lentiviral mouse Oas1b shRNA (UAS) (100)
GTR15261270 1 Vial

Lentiviral mouse Oas1b shRNA (UAS) - Lentiviral mouse Oas1b shRNA (UAS) (100)

Ask
View Details
Anti-SART3 Rabbit pAb
GB114236-50 50 μL

Anti-SART3 Rabbit pAb

Ask
View Details
PLCD3, NT (PLCD3, KIAA1964, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3, Phosphoinositide phospholipase C-delta-3, Phospholipase C-delta-3) (MaxLight 750) discontinued
040139-ML750 100 µL

PLCD3, NT (PLCD3, KIAA1964, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3, Phosphoinositide phospholipase C-delta-3, Phospholipase C-delta-3) (MaxLight 750) discontinued

Ask
View Details