Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clumping factor A, S. aureus

Clustering factor A (ClfA) is a virulence-related cell surface-associated protein that plays a key role in bacterial pathogenicity. It promotes bacterial attachment exclusively to the gamma chain of human fibrinogen, demonstrating the specificity of its interaction with host proteins. Clumping factor A Protein, S. aureus is the recombinant Staphylococcus aureus-derived Clumping factor A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Clumping factor A Protein, S. aureus, Staphylococcus aureus, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/clumping-factor-a-protein-s-aureus.html

Purity

97.00

Smiles

GKDITNQLTNVTVGIDSGDTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVDTKENVTANITMPAYIDPENVTKTGNVTLTTGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYDSRFVWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Molecular Formula

/ (Gene_ID) Q6GB45 (G228-E558) (Accession)

Molecular Weight

Approximately 43 kDa. The reducing (R) protein migrat es as 43 kDa in SDS-PAGE may be due to relative Charge.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TREM2 ORF Vector (Human) (pORF)
47700011 1.0 µg DNA

TREM2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
HLA-DOB Antibody
MBS7131387-01 0.1 mL

HLA-DOB Antibody

Sign In for Pricing
View Details
HLA-DOB Antibody
MBS7131387-02 5x 0.1 mL

HLA-DOB Antibody

Sign In for Pricing
View Details
C6ORF173 Polyclonal Antibody
bs-15230R 100 µL

C6ORF173 Polyclonal Antibody

Sign In for Pricing
View Details
Mmu-miR-3113-5p miRNA Mimic
CMM0820-01 5 nmol

Mmu-miR-3113-5p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-3113-5p miRNA Mimic
CMM0820-02 10 nmol

Mmu-miR-3113-5p miRNA Mimic

Sign In for Pricing
View Details