CD94, Human (HEK293, His)
CD94 protein is a key immune receptor for self-non-self discrimination. It forms a complex with KLRC1 or KLRC2 on lymphocyte subsets and recognizes HLA-E loaded with self-peptides. It allows cytotoxic cells to monitor MHC class I expression and promote self-tolerance. CD94 Protein, Human (HEK293, His) is the recombinant human-derived CD94 protein, expressed by HEK293 , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
CD94 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd94-protein-human-hek-293-his.html
Purity
96.23
Smiles
SFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
Molecular Formula
3824 (Gene_ID) Q13241-1 (S34-I179) (Accession)
Molecular Weight
23-28 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal LAP1 Antibody (RL13) [Alexa Fluor 594]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
Mouse Monoclonal LAP1 Antibody (RL13) [Alexa Fluor 594]
Mouse Immunoglobulin-Like Domain-Containing Receptor 2 (ILDR2) ELISA Kit
Mouse Immunoglobulin-Like Domain-Containing Receptor 2 (ILDR2) ELISA Kit
Mouse Immunoglobulin-Like Domain-Containing Receptor 2 (ILDR2) ELISA Kit
Mouse Immunoglobulin-Like Domain-Containing Receptor 2 (ILDR2) ELISA Kit
