Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Pig (His-SUMO)

Prolactin Protein plays a key role in the mammary gland by primarily promoting lactation through its interaction with the PRLR receptor, facilitating the lactation process. Prolactin Protein, Pig (His-SUMO) is the recombinant pig-derived Prolactin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Pig (His-SUMO), Pig, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-prl-pig-his-sumo.html

Purity

90.00

Smiles

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Molecular Formula

396965 (Gene_ID) P01238 (L31-C229) (Accession)

Molecular Weight

Approximately 39.0kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG2 (NM_201539) Human Recombinant Protein
TP320003M 100 µg

NDRG2 (NM_201539) Human Recombinant Protein

Sign In for Pricing
View Details
OLIG2 Mouse Monoclonal Antibody [Clone ID: UMAB294]
UM870183 30 µL

OLIG2 Mouse Monoclonal Antibody [Clone ID: UMAB294]

Sign In for Pricing
View Details
Recombinant Mouse Icam5 Protein (His Tag)
PDMM100085-01 20 µg

Recombinant Mouse Icam5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Icam5 Protein (His Tag)
PDMM100085-02 100 µg

Recombinant Mouse Icam5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Icam5 Protein (His Tag)
PDMM100085-03 500 µg

Recombinant Mouse Icam5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Icam5 Protein (His Tag)
PDMM100085-04 1 mg

Recombinant Mouse Icam5 Protein (His Tag)

Sign In for Pricing
View Details