Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Pig (His-SUMO)

Prolactin Protein plays a key role in the mammary gland by primarily promoting lactation through its interaction with the PRLR receptor, facilitating the lactation process. Prolactin Protein, Pig (His-SUMO) is the recombinant pig-derived Prolactin protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

Prolactin Protein, Pig (His-SUMO), Pig, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-prl-pig-his-sumo.html

Purity

90.00

Smiles

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Molecular Formula

396965 (Gene_ID) P01238 (L31-C229) (Accession)

Molecular Weight

Approximately 39.0kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBNL1 Adenovirus (Rat)
28177056 1.0 mL

MBNL1 Adenovirus (Rat)

Sign In for Pricing
View Details
VHL Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1367R-BF555-01 20 µL

VHL Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
VHL Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1367R-BF555-02 100 µL

VHL Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Mrps23 shRNA (UAS) - Lentiviral mouse Mrps23 shRNA (UAS, iRFP) (100)
GTR15287919 1 Vial

Lentiviral mouse Mrps23 shRNA (UAS) - Lentiviral mouse Mrps23 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-CD198/CCR8 (BMS-986340) Biosimilar (Monoclonal, IgG1-kappa)
A135783 100 µL

Anti-CD198/CCR8 (BMS-986340) Biosimilar (Monoclonal, IgG1-kappa)

Sign In for Pricing
View Details
NSA1 Antibody
5669-002mg 0.02 mg

NSA1 Antibody

Sign In for Pricing
View Details