Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP5, Human (His)

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cabp5-protein-human-his.html

Purity

93.63

Smiles

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Molecular Formula

56344 (Gene_ID) Q9NP86 (M1-R173) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GALT5 (NM_033173) Human Recombinant Protein
TP311183M 100 µg

B3GALT5 (NM_033173) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant RNase L Antibody
RC-16035-01 50 μL

Recombinant RNase L Antibody

Sign In for Pricing
View Details
Recombinant RNase L Antibody
RC-16035-02 100 µL

Recombinant RNase L Antibody

Sign In for Pricing
View Details
Recombinant RNase L Antibody
RC-16035-03 1 mL

Recombinant RNase L Antibody

Sign In for Pricing
View Details
TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
CF809537 100 µg

TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI1C12]

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631656 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details