Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP5, Human (His)

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cabp5-protein-human-his.html

Purity

93.63

Smiles

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Molecular Formula

56344 (Gene_ID) Q9NP86 (M1-R173) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Butanesultone
TRC-B701405-500MG 500 mg

2,4-Butanesultone

Sign In for Pricing
View Details
Mouse Mocs2 activation kit by CRISPRa
GA202692 1 Kit

Mouse Mocs2 activation kit by CRISPRa

Sign In for Pricing
View Details
RACGAP1 (NM_001126104) Human Recombinant Protein
TP326046L 1 mg

RACGAP1 (NM_001126104) Human Recombinant Protein

Sign In for Pricing
View Details
Phenyltoloxamine Citrate Salt
TRC-P337370-50MG 50 mg

Phenyltoloxamine Citrate Salt

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF740 conjugate, 0.1mg/mL
BNC742993-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (CA9/2993R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Human CD55 Antibody[HI55a]
AN00336G-01 20 Tests

PE/Cyanine5 Anti-Human CD55 Antibody[HI55a]

Sign In for Pricing
View Details