Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP5, Human (His)

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cabp5-protein-human-his.html

Purity

93.63

Smiles

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Molecular Formula

56344 (Gene_ID) Q9NP86 (M1-R173) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DRC7 activation kit by CRISPRa
GA113435 1 Kit

Human DRC7 activation kit by CRISPRa

Sign In for Pricing
View Details
VEGF Receptor 2 (KDR) pTyr996 Rabbit Polyclonal Antibody
AP12614PU-N 400 µL

VEGF Receptor 2 (KDR) pTyr996 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4,5,7-Tri-O-acetyl-2,6-anhydro-3-deoxy-D-lyxo-hept-2-enononitrile
TRC-T207615-100MG 100 mg

4,5,7-Tri-O-acetyl-2,6-anhydro-3-deoxy-D-lyxo-hept-2-enononitrile

Sign In for Pricing
View Details
Recombinant Human CXADR/CAR Protein (His Tag)
PKSH032284-01 10 µg

Recombinant Human CXADR/CAR Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CXADR/CAR Protein (His Tag)
PKSH032284-02 50 µg

Recombinant Human CXADR/CAR Protein (His Tag)

Sign In for Pricing
View Details
DYNLRB2 (Center) Rabbit Polyclonal Antibody
AP51348PU-N 400 µL

DYNLRB2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details