Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP5, Human (His)

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cabp5-protein-human-his.html

Purity

93.63

Smiles

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Molecular Formula

56344 (Gene_ID) Q9NP86 (M1-R173) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-sec-Butylphenol
TRC-B689910-25G 25 g

2-sec-Butylphenol

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF568 conjugate, 0.1mg/mL
BNC682714-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2714), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sample Concentrator BCON-108
BCON-108 1 Unit

Sample Concentrator BCON-108

Sign In for Pricing
View Details
EPS8L2 Rabbit Polyclonal Antibody
TA392788 100 µL

EPS8L2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), 0.2mg/mL
BNUB1620-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), 0.2mg/mL

Sign In for Pricing
View Details
Blood Bank Refrigerated Centrifuge BBRC-206
BBRC-206 1 Unit

Blood Bank Refrigerated Centrifuge BBRC-206

Sign In for Pricing
View Details