Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CABP5, Human (His)

The CABP5 protein acts as an inhibitor to regulate calcium-dependent inactivation of L-type calcium channels, converting the voltage dependence of activation to a more depolarizing membrane potential. It is involved in the transmission of light signals and may positively regulate endocytosis and exocytosis of neurotransmitter vesicles in a salt-dependent manner. CABP5 Protein, Human (His) is the recombinant human-derived CABP5 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

CABP5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cabp5-protein-human-his.html

Purity

93.63

Smiles

MQFPMGPACIFLRKGIAEKQRERPLGQDEIEELREAFLEFDKDRDGFISCKDLGNLMRTMGYMPTEMELIELGQQIRMNLGGRVDFDDFVELMTPKLLAETAGMIGVQEMRDAFKEFDTNGDGEITLVELQQAMQRLLGERLTPREISEVVREADVNGDGTVDFEEFVKMMSR

Molecular Formula

56344 (Gene_ID) Q9NP86 (M1-R173) (Accession)

Molecular Weight

Approximately 19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPC302 (TBCK) (NM_001163435) Human Tagged ORF Clone
RC228610 10 µg

HSPC302 (TBCK) (NM_001163435) Human Tagged ORF Clone

Sign In for Pricing
View Details
MYL7 antibody
70R-18712 50 ul

MYL7 antibody

Sign In for Pricing
View Details
Rabbit Polyclonal LCAT Antibody
NBP3-00108-100ul 100 µL

Rabbit Polyclonal LCAT Antibody

Sign In for Pricing
View Details
CTNNA2 Antibody
E19-9347-1 50 µg - 50 µL

CTNNA2 Antibody

Sign In for Pricing
View Details
Human TREM-1 DuoSet ELISA
DY1278B 15 Plates

Human TREM-1 DuoSet ELISA

Sign In for Pricing
View Details
Hnrnpf (NM_001166430) Mouse Tagged ORF Clone Lentiviral Particle
MR217114L3V 200 µL

Hnrnpf (NM_001166430) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details