Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free IL-15, Mouse (His)

The IL-15 protein is a cytokine that crucially shapes inflammatory and protective immune responses by regulating innate and adaptive immune cells. It stimulates the proliferation and activation of natural killer cells, T cells and B cells, and promotes the secretion of cytokines. Animal-Free IL-15 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-15 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free IL-15 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-il-15-protein-mouse-his.html

Purity

98.00

Smiles

NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS

Molecular Formula

16168 (Gene_ID) P48346 (N49-S162) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2C Antibody (S396) [AMM06362G]
AMM06362G-01 50 µL

MEF2C Antibody (S396) [AMM06362G]

Sign In for Pricing
View Details
MEF2C Antibody (S396) [AMM06362G]
AMM06362G-02 100 µL

MEF2C Antibody (S396) [AMM06362G]

Sign In for Pricing
View Details
MEF2C Antibody (S396) [AMM06362G]
AMM06362G-03 200 µL

MEF2C Antibody (S396) [AMM06362G]

Sign In for Pricing
View Details
MEF2C Antibody (S396) [AMM06362G]
AMM06362G-04 400 µL

MEF2C Antibody (S396) [AMM06362G]

Sign In for Pricing
View Details
SLITRK2 (NM_001144009) Human Tagged ORF Clone
RG227530 10 µg

SLITRK2 (NM_001144009) Human Tagged ORF Clone

Sign In for Pricing
View Details
PRLR 293 Cell Lysate
410103 0.1 mg

PRLR 293 Cell Lysate

Sign In for Pricing
View Details