Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

Product Specifications

Product Name Alternative

Ns3b; Accessory protein 3b

Abbreviation

Recombinant Avian infectious bronchitis virus Non-structural protein 3b

Gene Name

3b

UniProt

P30243

Expression Region

1-63aa

Organism

Avian infectious bronchitis virus (strain UK/68/84) (IBV)

Target Sequence

MLDFEAIIEAGEQLIQKISFDLQHISSVLNTQVFDPFEYCYYRGGSFWEIESAEEFSGDDEFT

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.8 kDa

References & Citations

"A polycistronic mRNA specified by the coronavirus infectious bronchitis virus." Liu D.X., Cavanagh D., Green P., Inglis S.C. Virology 184:531-544 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Citrate
TRC-S655008-10G 10 g

Sodium Citrate

Sign In for Pricing
View Details
Histone H2B Rabbit Polyclonal Antibody
AP20239PU-N 100 µg

Histone H2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human OR1S2 activation kit by CRISPRa
GA116538 1 Kit

Human OR1S2 activation kit by CRISPRa

Sign In for Pricing
View Details
Miconazole Nitrate
TRC-M342500-5G 5 g

Miconazole Nitrate

Sign In for Pricing
View Details
Recombinant Calpain small subunit 1 Monoclonal Antibody
AN301453L-01 50 µL

Recombinant Calpain small subunit 1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Calpain small subunit 1 Monoclonal Antibody
AN301453L-02 100 µL

Recombinant Calpain small subunit 1 Monoclonal Antibody

Sign In for Pricing
View Details