Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Daboia palaestinae Disintegrin viperistatin

Product Specifications

Abbreviation

Recombinant Daboia palaestinae Disintegrin viperistatin protein

UniProt

P0C6E2

Expression Region

1-41aa

Organism

Daboia palaestinae (Palestine viper) (Vipera palaestinae)

Target Sequence

CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Potent and highly selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin binding to collagen I and IV. Is about 25-fold more potent than obtustatin inhibiting the binding of this integrin to collagen IV.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.2 kDa

References & Citations

"Structural determinants of the selectivity of KTS-disintegrins for the alpha1beta1 integrin." Kisiel D.G., Calvete J.J., Katzhendler J., Fertala A., Lazarovici P., Marcinkiewicz C. FEBS Lett. 577:478-482 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hetacillin
TRC-H289570-1G 1 g

Hetacillin

Sign In for Pricing
View Details
Lentiviral mouse Adh6a shRNA (UAS) - Lentiviral mouse Adh6a shRNA (UAS, RFP) plasmid
GTR15136681 1 Vial

Lentiviral mouse Adh6a shRNA (UAS) - Lentiviral mouse Adh6a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
IL32 cDNA Clone
MBS1276278-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

IL32 cDNA Clone

Sign In for Pricing
View Details
IL32 cDNA Clone
MBS1276278-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

IL32 cDNA Clone

Sign In for Pricing
View Details
RFPL4B Antibody
GWB-MP327C 50 µg

RFPL4B Antibody

Sign In for Pricing
View Details
ASPM Antibody, HRP conjugated
MBS7104254-01 0.05 mg

ASPM Antibody, HRP conjugated

Sign In for Pricing
View Details