Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Daboia palaestinae Disintegrin viperistatin

Product Specifications

Abbreviation

Recombinant Daboia palaestinae Disintegrin viperistatin protein

UniProt

P0C6E2

Expression Region

1-41aa

Organism

Daboia palaestinae (Palestine viper) (Vipera palaestinae)

Target Sequence

CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG

Tag

C-terminal 6xHis-Myc-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Potent and highly selective inhibitor of alpha-1/beta-1 (ITGA1/ITGB1) integrin binding to collagen I and IV. Is about 25-fold more potent than obtustatin inhibiting the binding of this integrin to collagen IV.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.2 kDa

References & Citations

"Structural determinants of the selectivity of KTS-disintegrins for the alpha1beta1 integrin." Kisiel D.G., Calvete J.J., Katzhendler J., Fertala A., Lazarovici P., Marcinkiewicz C. FEBS Lett. 577:478-482 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGAP8 (AGAP4) Rabbit Polyclonal Antibody
TA333550 100 µL

AGAP8 (AGAP4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RGD1308114 Protein Vector (Rat) (pPM-C-HA)
39024026 500 ng

RGD1308114 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Paqr6 (NM_198410) Mouse Tagged ORF Clone
MG216535 10 µg

Paqr6 (NM_198410) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Brass Tubes
1120142/1B 1 Each

Brass Tubes

Sign In for Pricing
View Details
Txnl4b Rat shRNA Plasmid (Locus ID 292008)
TR702030 1 Kit

Txnl4b Rat shRNA Plasmid (Locus ID 292008)

Sign In for Pricing
View Details
Ces1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6301305 3x 1.0 µg

Ces1a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details