TCL1A, Human (His)
TCL1A protein plays a crucial role in cell signaling by actively enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3 while promoting the nuclear translocation of AKT1. Additionally, it aids cell proliferation, stabilizes mitochondrial membrane potential, and promotes cell survival. TCL1A Protein, Human (His) is the recombinant human-derived TCL1A protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
TCL1A Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tcl1a-protein-human-his.html
Purity
96.00
Smiles
AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Molecular Formula
8115 (Gene_ID) P56279 (A2-D114) (Accession)
Molecular Weight
Approximately 14 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Qualitative Human Transfusion Transmitted Virus Antibody IgG (TTV-IgG) ELISA Kit
Qualitative Human Transfusion Transmitted Virus Antibody IgG (TTV-IgG) ELISA Kit
Qualitative Human Transfusion Transmitted Virus Antibody IgG (TTV-IgG) ELISA Kit
Qualitative Human Transfusion Transmitted Virus Antibody IgG (TTV-IgG) ELISA Kit
