Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1A, Human (His)

TCL1A protein plays a crucial role in cell signaling by actively enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3 while promoting the nuclear translocation of AKT1. Additionally, it aids cell proliferation, stabilizes mitochondrial membrane potential, and promotes cell survival. TCL1A Protein, Human (His) is the recombinant human-derived TCL1A protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TCL1A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcl1a-protein-human-his.html

Purity

96.00

Smiles

AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Molecular Formula

8115 (Gene_ID) P56279 (A2-D114) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal BST2 Antibody (2E2) [Alexa Fluor 700]
NBP2-29621AF700 0.1 mL

Mouse Monoclonal BST2 Antibody (2E2) [Alexa Fluor 700]

Ask
View Details
Ifna1 (NM_010502) Mouse Tagged ORF Clone
MG226585 10 µg

Ifna1 (NM_010502) Mouse Tagged ORF Clone

Ask
View Details
CNDP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
TA502097AM 100 µL

CNDP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]

Ask
View Details
EPB41L5 (NM_001184938) Human Tagged ORF Clone Lentiviral Particle
RC230195L3V 200 µL

EPB41L5 (NM_001184938) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
NETO2, NT (NETO2, BTCL2, Neuropilin and tolloid-like protein 2, Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2) (Azide free) (HRP) discontinued
038901-HRP 200 µL

NETO2, NT (NETO2, BTCL2, Neuropilin and tolloid-like protein 2, Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2) (Azide free) (HRP) discontinued

Ask
View Details