Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1A, Human (His)

TCL1A protein plays a crucial role in cell signaling by actively enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3 while promoting the nuclear translocation of AKT1. Additionally, it aids cell proliferation, stabilizes mitochondrial membrane potential, and promotes cell survival. TCL1A Protein, Human (His) is the recombinant human-derived TCL1A protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TCL1A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcl1a-protein-human-his.html

Purity

96.00

Smiles

AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Molecular Formula

8115 (Gene_ID) P56279 (A2-D114) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Goose Gamma-Aminobutyric Acid Receptor Subunit Beta-3 (GABRB3) ELISA Kit
MBS9913643 Inquire

Goose Gamma-Aminobutyric Acid Receptor Subunit Beta-3 (GABRB3) ELISA Kit

Ask
View Details
AP2D Polyclonal Antibody
ABP57784-01 30 µL

AP2D Polyclonal Antibody

Ask
View Details
AP2D Polyclonal Antibody
ABP57784-02 100 µL

AP2D Polyclonal Antibody

Ask
View Details
AP2D Polyclonal Antibody
ABP57784-03 200 µL

AP2D Polyclonal Antibody

Ask
View Details
TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 750)
MBS6357085-01 0.1 mL

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 750)

Ask
View Details
TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 750)
MBS6357085-02 5x 0.1 mL

TNFSF4, ID (TNFSF4, TXGP1, Tumor necrosis factor ligand superfamily member 4, Glycoprotein Gp34, OX40 ligand, TAX transcriptionally-activated glycoprotein 1, CD252) (MaxLight 750)

Ask
View Details