Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCL1A, Human (His)

TCL1A protein plays a crucial role in cell signaling by actively enhancing the phosphorylation and activation of AKT1, AKT2, and AKT3 while promoting the nuclear translocation of AKT1. Additionally, it aids cell proliferation, stabilizes mitochondrial membrane potential, and promotes cell survival. TCL1A Protein, Human (His) is the recombinant human-derived TCL1A protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

TCL1A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tcl1a-protein-human-his.html

Purity

96.00

Smiles

AECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD

Molecular Formula

8115 (Gene_ID) P56279 (A2-D114) (Accession)

Molecular Weight

Approximately 14 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HT Chemiluminescent PARP Apoptosis Assay Kit
4685-096-K 96 Tests

HT Chemiluminescent PARP Apoptosis Assay Kit

Ask
View Details
Bat coronavirus RaTG13 Spike Trimer Protein (R681A, KV982-983PP), His Tag
SPN-B52H4-50ug 50 µg

Bat coronavirus RaTG13 Spike Trimer Protein (R681A, KV982-983PP), His Tag

Ask
View Details
FLJ20643 (PIH1 Domain Containing 1, FLJ20643, NOP17) (APC)
MBS6166414-01 0.1 mL

FLJ20643 (PIH1 Domain Containing 1, FLJ20643, NOP17) (APC)

Ask
View Details
FLJ20643 (PIH1 Domain Containing 1, FLJ20643, NOP17) (APC)
MBS6166414-02 5x 0.1 mL

FLJ20643 (PIH1 Domain Containing 1, FLJ20643, NOP17) (APC)

Ask
View Details
COX4I1 (Cytochrome c oxidase subunit IV isoform 1)
030110 100 µL

COX4I1 (Cytochrome c oxidase subunit IV isoform 1)

Ask
View Details
Lentiviral human GAK sgRNA gene knockout kit - Lentiviral human GAK sgRNA gene knockout kit (100)
GTR15369931 1 Vial

Lentiviral human GAK sgRNA gene knockout kit - Lentiviral human GAK sgRNA gene knockout kit (100)

Ask
View Details