Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REG-3 gamma/REG3G, Human (HEK293, His)

REG-3 gamma/REG3G protein is a bactericidal C-type lectin that specifically targets Gram-positive bacteria by binding to the peptidoglycan surface moiety, mediating bacterial killing. It limits bacterial colonization of intestinal epithelial surfaces and limits microbiota-induced adaptive immune responses. REG-3 gamma/REG3G Protein, Human (HEK293, His) is the recombinant human-derived REG-3 gamma/REG3G protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

REG-3 gamma/REG3G Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/reg3-gamma-protein-human-hek-293-his.html

Purity

95.0

Smiles

EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD

Molecular Formula

130120 (Gene_ID) Q6UW15-1 (E27-D175) (Accession)

Molecular Weight

17-19 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALCA Mouse Monoclonal Antibody [Clone 9H2]
EN5445009 each

CALCA Mouse Monoclonal Antibody [Clone 9H2]

Sign In for Pricing
View Details
Rat Afp (Alpha-fetoprotein) ELISA Kit
EKF57860 96 Tests

Rat Afp (Alpha-fetoprotein) ELISA Kit

Sign In for Pricing
View Details
1H,1H,2H,2H-Perfluorodecylamine
TRC-P286598-50MG 50 mg

1H,1H,2H,2H-Perfluorodecylamine

Sign In for Pricing
View Details
D2HGDH Polyclonal Antibody, Biotin Conjugated
A58719-050 50 µL

D2HGDH Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
D-Histidine
T9372 5 g

D-Histidine

Sign In for Pricing
View Details
NFkB p65 antibody (Thr505)
70R-37243 0.1 mg

NFkB p65 antibody (Thr505)

Sign In for Pricing
View Details