Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tissue Factor, Rat (HEK293, His)

Tissue Factor Protein plays a critical role in blood coagulation.It binds to coagulation factors, activating clotting cascades.Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation.Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases.Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Tissue Factor Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tissue-factor-protein-rat-hek293-his.html

Purity

95.0

Smiles

MAIPMRPRLLAALAPTFLGFLLLQVAAGAGTPPGKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKYKCTGTTDTECDLTDEIVKDVNWTYEARVLSVPWRNSTHGKETLFGTHGEEPPFTNARKFLPYRDTKIGQPVIQKYEQDGTKLKVTVKDSFTLVRKNGTFLTLRQVFGNDLGYILTYRKDSSTGRKTNTTHTNEFLIDVEKGVSYCFFVQAVIFSRKTNHKSPESITKCTEQWKSVLGE

Molecular Formula

25584 (Gene_ID) Q66HI4 (A29-E252) (Accession)

Molecular Weight

47-52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Parotid gland
CS701091 5x 5 µm

Tissue FFPE Sections, Parotid gland

Sign In for Pricing
View Details
CD147 (BSG) (NM_198591) Human Recombinant Protein
TP319418L 1 mg

CD147 (BSG) (NM_198591) Human Recombinant Protein

Sign In for Pricing
View Details
Uridine Diphosphate Choline Ammonium Salt
TRC-U829930-1MG 1 mg

Uridine Diphosphate Choline Ammonium Salt

Sign In for Pricing
View Details
MMP1 Rabbit Polyclonal Antibody
AP06224PU-N 100 µg

MMP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G3]
TA505610BM 100 µL

CA12 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G3]

Sign In for Pricing
View Details
RNASE11 Mouse Monoclonal Antibody [Clone ID: OTI1H3]
CF810535 100 µg

RNASE11 Mouse Monoclonal Antibody [Clone ID: OTI1H3]

Sign In for Pricing
View Details