Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tissue Factor, Rat (HEK293, His)

Tissue Factor Protein plays a critical role in blood coagulation.It binds to coagulation factors, activating clotting cascades.Tissue Factor Protein interacts with cells, promoting thrombosis and inflammation.Understanding its functions can aid in developing treatments for blood disorders and cardiovascular diseases.Tissue Factor Protein, Rat (HEK293, His) is the recombinant rat-derived Tissue Factor protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Tissue Factor Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tissue-factor-protein-rat-hek293-his.html

Purity

95.0

Smiles

MAIPMRPRLLAALAPTFLGFLLLQVAAGAGTPPGKAFNLTWISTDFKTILEWQPKPTNYTYTVQISDRSRNWKYKCTGTTDTECDLTDEIVKDVNWTYEARVLSVPWRNSTHGKETLFGTHGEEPPFTNARKFLPYRDTKIGQPVIQKYEQDGTKLKVTVKDSFTLVRKNGTFLTLRQVFGNDLGYILTYRKDSSTGRKTNTTHTNEFLIDVEKGVSYCFFVQAVIFSRKTNHKSPESITKCTEQWKSVLGE

Molecular Formula

25584 (Gene_ID) Q66HI4 (A29-E252) (Accession)

Molecular Weight

47-52 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDE5A Rabbit Polyclonal Antibody (AP)
orb897944 100 µL

PDE5A Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Recombinant Clostridium Botulinum recR Protein (aa 1-198) (strain Langeland / NCTC 10281 / Type F)
VAng-Lsx8463-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Botulinum recR Protein (aa 1-198) (strain Langeland / NCTC 10281 / Type F)

Sign In for Pricing
View Details
Lentiviral mouse Mettl17 shRNA (UAS) - Lentiviral mouse Mettl17 shRNA (UAS, iRFP) (25)
GTR15258902 1 Vial

Lentiviral mouse Mettl17 shRNA (UAS) - Lentiviral mouse Mettl17 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
LysRS Lentiviral Activation Particles (h)
sc-404110-LAC 200 µL

LysRS Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Rat Glutamate Cysteine Ligase, Catalytic (GCLC) Antibody Pair Kit (with Standard)
MBS2102738-01 5x 96 Tests

Rat Glutamate Cysteine Ligase, Catalytic (GCLC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Rat Glutamate Cysteine Ligase, Catalytic (GCLC) Antibody Pair Kit (with Standard)
MBS2102738-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Rat Glutamate Cysteine Ligase, Catalytic (GCLC) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details