Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2W, Human (His)

UBE2W protein is a multifunctional ubiquitin-conjugating enzyme that accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to different substrates. Notably, UBE2W uniquely monoubiquitylates the N-terminus, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showing specificity for disordered N-termini. UBE2W Protein, Human (His) is the recombinant human-derived UBE2W protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

UBE2W Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2w-protein-human-his.html

Purity

95.00

Smiles

MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

Molecular Formula

55284 (Gene_ID) Q96B02-1 (M1-C151) (Accession)

Molecular Weight

Approximately 18kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,5,6-tri (2-pyridyl) -1,2,4-triazine
OR28525 1 Each

3,5,6-tri (2-pyridyl) -1,2,4-triazine

Sign In for Pricing
View Details
ZBTB8B, CT (ZBTB8B, Zinc finger and BTB domain-containing protein 8B) (MaxLight 550) discontinued
044011-ML550 100 µL

ZBTB8B, CT (ZBTB8B, Zinc finger and BTB domain-containing protein 8B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
NCOA4 Antibody
orb1330142 100 µg

NCOA4 Antibody

Sign In for Pricing
View Details
Mouse Anti-Chicken CD44 Monoclonal Antibody-[APC]
VD7N281 1 Each

Mouse Anti-Chicken CD44 Monoclonal Antibody-[APC]

Sign In for Pricing
View Details
AI314976 Protein Lysate (Mouse) with C-HA Tag
11570034 100 µg

AI314976 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
A1 (B-3) Alexa Fluor® 546
sc-166943 AF546 200 µg/mL

A1 (B-3) Alexa Fluor® 546

Sign In for Pricing
View Details