Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP14, Human (His)

DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

DUSP14 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dusp14-protein-human-his-mbp.html

Purity

96.0

Smiles

MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH

Molecular Formula

11072 (Gene_ID) O95147 (M1-H191) (Accession)

Molecular Weight

Approximately 21-23 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTI2 Recombinant Protein (Mouse)
RP182111 100 µg

TTI2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
XFD647 Anti-human CD40 Antibody *G28.5*
10401180-AAT 100 Tests

XFD647 Anti-human CD40 Antibody *G28.5*

Sign In for Pricing
View Details
DEFB103A ELISA Kit (Human) (OKCD08605)
OKCD08605 96 Well

DEFB103A ELISA Kit (Human) (OKCD08605)

Sign In for Pricing
View Details
(3-Bromo-2-isopropoxyphenyl) (methyl) sulfane
OR1097922-01 250 mg

(3-Bromo-2-isopropoxyphenyl) (methyl) sulfane

Sign In for Pricing
View Details
(3-Bromo-2-isopropoxyphenyl) (methyl) sulfane
OR1097922-02 500 mg

(3-Bromo-2-isopropoxyphenyl) (methyl) sulfane

Sign In for Pricing
View Details
(3-Bromo-2-isopropoxyphenyl) (methyl) sulfane
OR1097922-03 1 g

(3-Bromo-2-isopropoxyphenyl) (methyl) sulfane

Sign In for Pricing
View Details