DUSP14, Human (His)
DUSP14 protein can inactivate MAP kinase and dephosphorylate ERK, JNK and p38 MAP kinase. Its negative regulation extends to TCR signaling, where DUSP14 dephosphorylates the MAP3K7 adapter TAB1, resulting in inactivation. DUSP14 Protein, Human (His-MBP) is the recombinant human-derived DUSP14 protein, expressed by E. coli , with N-His labeled tag.
Product Specifications
Product Name Alternative
DUSP14 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/dusp14-protein-human-his-mbp.html
Purity
96.0
Smiles
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRH
Molecular Formula
11072 (Gene_ID) O95147 (M1-H191) (Accession)
Molecular Weight
Approximately 21-23 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1293136-01 0.5 mg (E-Coli)
Recombinant Vibrio cholerae serotype O1 Protein HflC (hflC), partial
Sign In for Pricing
View Details MBS1293136-02 0.05 mg (Baculovirus)
Recombinant Vibrio cholerae serotype O1 Protein HflC (hflC), partial
Sign In for Pricing
View Details MBS1293136-03 0.5 mg (Yeast)
Recombinant Vibrio cholerae serotype O1 Protein HflC (hflC), partial
Sign In for Pricing
View Details MBS1293136-04 0.05 mg (Mammalian-Cell)
Recombinant Vibrio cholerae serotype O1 Protein HflC (hflC), partial
Sign In for Pricing
View Details