Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epithelial cell adhesion molecule (Epcam), partial

Product Specifications

Product Name Alternative

Epithelial glycoprotein 314 Short name: EGP314 Short name: mEGP314 Protein 289A Tumor-associated calcium signal transducer 1 CD_antigen: CD326

Abbreviation

Recombinant Mouse Epcam protein, partial

Gene Name

Epcam

UniProt

Q99JW5

Expression Region

24-266aa

Organism

Mus musculus (Mouse)

Target Sequence

QRDCVCDNYKLATSCSLNEYGECQCTSYGTQNTVICSKLASKCLAMKAEMTHSKSGRRIKPEGAIQNNDGLYDPDCDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERESPYDHQSLQTALQEAFTSRYKLNQKFIKNIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGEPLDLDPGQTLIYYVDEKAPEFSMQGLT

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Cell-cell adhesion

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Equine Serum Amyloid A (SAA) Monoclonal Antibody
VD11N6 1 Each

Mouse Anti-Equine Serum Amyloid A (SAA) Monoclonal Antibody

Sign In for Pricing
View Details
Inhibitor hsa-miR-135b-5p AAV miRNA Vector
Amh3017400 500 ng

Inhibitor hsa-miR-135b-5p AAV miRNA Vector

Sign In for Pricing
View Details
Recombinant ASFV Ken-008 Protein (aa 20-113)
VAng-0793Lsx-500g 500 µg

Recombinant ASFV Ken-008 Protein (aa 20-113)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yddT (yddT)
MBS1087082-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein yddT (yddT)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yddT (yddT)
MBS1087082-02 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein yddT (yddT)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yddT (yddT)
MBS1087082-03 0.02 mg (Yeast)

Recombinant Bacillus subtilis Uncharacterized protein yddT (yddT)

Sign In for Pricing
View Details