Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Vinexin (SORBS3) activation kit by CRISPRa
GA106912 1 Kit

Human Vinexin (SORBS3) activation kit by CRISPRa

Sign In for Pricing
View Details
Mettl16 (NM_026197) Mouse Tagged ORF Clone Lentiviral Particle
MR208777L3V 200 µL

Mettl16 (NM_026197) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
C16orf81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0313806 1.0 µg DNA

C16orf81 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Phospho-ETS1 (Thr38) Rabbit pAb
E47R13113 100 µL

Phospho-ETS1 (Thr38) Rabbit pAb

Sign In for Pricing
View Details
PLAC8 discontinued
512859 100 µg

PLAC8 discontinued

Sign In for Pricing
View Details
p-Nitrophenyl Phosphate (Tablets)
41480004-2 1000 Tablet(s)

p-Nitrophenyl Phosphate (Tablets)

Sign In for Pricing
View Details