Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZSCAN4 Mouse Monoclonal Antibody [Clone ID: OTI3D1]
CF800431 100 µg

ZSCAN4 Mouse Monoclonal Antibody [Clone ID: OTI3D1]

Sign In for Pricing
View Details
Mcc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4667105 3x 1.0 µg

Mcc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
42 Antibody
MBS7164800 Inquire

42 Antibody

Sign In for Pricing
View Details
Ccdc137 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3029802 1.0 µg DNA

Ccdc137 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Prss34-set siRNA/shRNA/RNAi Lentivector (Rat)
37846096 4x 500 ng

Prss34-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
SRRD, ID (SRRD, SRR1L, SRR1-like protein, SRR1 domain-containing protein) (AP) discontinued
042316-AP 200 µL

SRRD, ID (SRRD, SRR1L, SRR1-like protein, SRR1 domain-containing protein) (AP) discontinued

Sign In for Pricing
View Details