Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIT1 Polyclonal Antibody, PE Conjugated
bs-6077R-PE 100 µL

NIT1 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
C17orf100 Knockout Hela Polyclonal Cells
ARG37672 1 Million

C17orf100 Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
Ring Finger Protein 4 (RNF4) Antibody
abx313048-01 20 µg

Ring Finger Protein 4 (RNF4) Antibody

Sign In for Pricing
View Details
Ring Finger Protein 4 (RNF4) Antibody
abx313048-02 50 µg

Ring Finger Protein 4 (RNF4) Antibody

Sign In for Pricing
View Details
Ring Finger Protein 4 (RNF4) Antibody
abx313048-03 100 µg

Ring Finger Protein 4 (RNF4) Antibody

Sign In for Pricing
View Details
Ring Finger Protein 4 (RNF4) Antibody
abx313048-04 200 µg

Ring Finger Protein 4 (RNF4) Antibody

Sign In for Pricing
View Details