Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

G2E3 siRNA (Human)
MBS8204994-01 15 nmol

G2E3 siRNA (Human)

Sign In for Pricing
View Details
G2E3 siRNA (Human)
MBS8204994-02 30 nmol

G2E3 siRNA (Human)

Sign In for Pricing
View Details
G2E3 siRNA (Human)
MBS8204994-03 5x 30 nmol

G2E3 siRNA (Human)

Sign In for Pricing
View Details
Zinc finger protein 784 (ZNF784) Mouse ELISA Kit
I3930 96 Tests

Zinc finger protein 784 (ZNF784) Mouse ELISA Kit

Sign In for Pricing
View Details
HEG1 (NM_020733) Human Tagged Lenti ORF Clone
RC212168L4 10 µg

HEG1 (NM_020733) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SFRS11 Protein Vector (Human) (pPM-C-HA)
43588021 500 ng

SFRS11 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details