Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC37 3'UTR GFP Stable Cell Line
TU077425 1.0 mL

TTC37 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit
MBS9356608-01 48 Well

Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit

Sign In for Pricing
View Details
Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit
MBS9356608-02 96 Well

Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit

Sign In for Pricing
View Details
Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit
MBS9356608-03 5x 96 Well

Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit

Sign In for Pricing
View Details
Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit
MBS9356608-04 10x 96 Well

Monkey Sodium Channel Protein Type 9 Subunit Alpha (SCN9A) ELISA Kit

Sign In for Pricing
View Details
CD1a (CD1, CD1A Antigen, Cortical Thymocyte Antigen CD1A, Epidermal Dendritic Cell Marker CD1a, FCB 6, HTA1, T Cell Surface Antigen Leu 6, Cell Surface Antigen T6, T Cell Surface Antigen T6/Leu 6, T Cell Surface Glycoprotein CD1A, T6, Thymocyte Antigen CD1A) (PE)
C2252-01W-PE 100 µL

CD1a (CD1, CD1A Antigen, Cortical Thymocyte Antigen CD1A, Epidermal Dendritic Cell Marker CD1a, FCB 6, HTA1, T Cell Surface Antigen Leu 6, Cell Surface Antigen T6, T Cell Surface Antigen T6/Leu 6, T Cell Surface Glycoprotein CD1A, T6, Thymocyte Antigen CD1A) (PE)

Sign In for Pricing
View Details