Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

100ml Plastic Jar with White Wadded Screw Lid
PVC100-672W 672 Pack

100ml Plastic Jar with White Wadded Screw Lid

Sign In for Pricing
View Details
Rabbit anti-Xenotropic MuLV-related virus (isolate VP35)(XMRV) ENV Polyclonal Antibody
MBS7192649 Inquire

Rabbit anti-Xenotropic MuLV-related virus (isolate VP35)(XMRV) ENV Polyclonal Antibody

Sign In for Pricing
View Details
Prelid1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
37594114 3x 1.0 µg

Prelid1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
AKAP3 Peptide
AF0529-BP 1 mg

AKAP3 Peptide

Sign In for Pricing
View Details
Lentiviral human CASP1 shRNA (UAS) - Lentiviral human CASP1 shRNA (UAS, GFP) (100)
GTR15323664 1 Vial

Lentiviral human CASP1 shRNA (UAS) - Lentiviral human CASP1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
CDK4 Antibody
MBS9403193-01 0.1 mL

CDK4 Antibody

Sign In for Pricing
View Details