Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR4504 ORF Vector (Human) (pORF)
ORF024410 1.0 µg DNA

MIR4504 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Cavy Neuronal Membrane Glycoprotein M6-A (GPM6A) ELISA Kit
MBS9355076 Inquire

Cavy Neuronal Membrane Glycoprotein M6-A (GPM6A) ELISA Kit

Sign In for Pricing
View Details
Peli1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4781702 1.0 µg DNA

Peli1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Lentiviral mouse Car2 shRNA (UAS) - Lentiviral mouse Car2 shRNA (UAS, iRFP) plasmid
GTR15268600 1 Vial

Lentiviral mouse Car2 shRNA (UAS) - Lentiviral mouse Car2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
WDFY4 (WD Repeat and FYVE Domain-containing Protein 4, C10orf64) (MaxLight 550)
MBS6443366-01 0.1 mL

WDFY4 (WD Repeat and FYVE Domain-containing Protein 4, C10orf64) (MaxLight 550)

Sign In for Pricing
View Details
WDFY4 (WD Repeat and FYVE Domain-containing Protein 4, C10orf64) (MaxLight 550)
MBS6443366-02 5x 0.1 mL

WDFY4 (WD Repeat and FYVE Domain-containing Protein 4, C10orf64) (MaxLight 550)

Sign In for Pricing
View Details