Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM41 Human shRNA Plasmid Kit (Locus ID 55285)
TL307112 1 Kit

RBM41 Human shRNA Plasmid Kit (Locus ID 55285)

Sign In for Pricing
View Details
SMU1 (WD40 Repeat-containing Protein SMU1, Smu-1 Suppressor of Mec-8 and Unc-52 Protein Homolog, SMU-1) (AP) discontinued
133588-AP 100 µL

SMU1 (WD40 Repeat-containing Protein SMU1, Smu-1 Suppressor of Mec-8 and Unc-52 Protein Homolog, SMU-1) (AP) discontinued

Sign In for Pricing
View Details
IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (APC)
I3000-36-APC 100 µL

IKK gamma (IKK3, NEMO, FIP3, IKKAP1, IkappaB Kinase gamma, IKKg) (APC)

Sign In for Pricing
View Details
Synthetic pyrethroid insecticide
AG123 1 mg

Synthetic pyrethroid insecticide

Sign In for Pricing
View Details
Human FGF7 ELISA Kit
MBS824576-01 96 Tests

Human FGF7 ELISA Kit

Sign In for Pricing
View Details
Human FGF7 ELISA Kit
MBS824576-02 5x 96 Tests

Human FGF7 ELISA Kit

Sign In for Pricing
View Details