Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Tagged ORF Clone
RC210897 10 µg

Macrophage Inflammatory Protein 3 (CCL23) (NM_145898) Human Tagged ORF Clone

Sign In for Pricing
View Details
AMZ1 3'UTR GFP Stable Cell Line
TU050724 1.0 mL

AMZ1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
RYK Polyclonal Antibody
E55A00851 100 µg

RYK Polyclonal Antibody

Sign In for Pricing
View Details
CAT (Catalase, MGC138422, MGC138424) (Biotin)
124371-Biotin 100 µL

CAT (Catalase, MGC138422, MGC138424) (Biotin)

Sign In for Pricing
View Details
T-705 (Favipiravir) 500mg
A11590-500 500 mg

T-705 (Favipiravir) 500mg

Sign In for Pricing
View Details
SPPL2a (1C7) : m-IgG1 BP-HRP Bundle
sc-542020 1 Kit

SPPL2a (1C7) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details