Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMP Free Acid
40190016-3 25 g

AMP Free Acid

Sign In for Pricing
View Details
Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody
abx328219-01 50 µg

Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody

Sign In for Pricing
View Details
Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody
abx328219-02 100 µg

Discoidin Domain Receptor Family, Member 1 Phospho-Tyr513 (DDR1 pY513) Antibody

Sign In for Pricing
View Details
Lentiviral human NDNF sgRNA gene knockout kit - Lentiviral human NDNF sgRNA gene knockout kit (25)
GTR15360381 1 Vial

Lentiviral human NDNF sgRNA gene knockout kit - Lentiviral human NDNF sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Scnm1 (NM_001163573) Mouse Tagged Lenti ORF Clone
MR215391L4 10 µg

Scnm1 (NM_001163573) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CLDN11 ORF Vector (Human) (pORF)
ORF002411 1.0 µg DNA

CLDN11 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details