Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-AK7
YF-PA22048 50 ul

anti-AK7

Sign In for Pricing
View Details
Anti-Spike glycoprotein (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)
A134397 100 µL

Anti-Spike glycoprotein (Recombinant Alpaca, Monoclonal, VHH-8His-Cys-tag)

Sign In for Pricing
View Details
Human T-bet/TBX21 Alexa Fluor 647 Antibody (Clone 525803)
IC5385R-100UG 100 µg

Human T-bet/TBX21 Alexa Fluor 647 Antibody (Clone 525803)

Sign In for Pricing
View Details
MAP3K4 Protein Vector (Mouse) (pPB-C-His)
PV198978 500 ng

MAP3K4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
IL7R (Interleukin 7 Receptor, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA) (MaxLight 650)
MBS6422599-01 0.1 mL

IL7R (Interleukin 7 Receptor, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA) (MaxLight 650)

Sign In for Pricing
View Details
IL7R (Interleukin 7 Receptor, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA) (MaxLight 650)
MBS6422599-02 5x 0.1 mL

IL7R (Interleukin 7 Receptor, CD127, CDW127, IL-7R-alpha, IL7RA, ILRA) (MaxLight 650)

Sign In for Pricing
View Details