Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r93 3'UTR Luciferase Stable Cell Line
TU122099 1.0 mL

Vmn2r93 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Canine A-kinase anchor protein 10mitochondrial (AKAP10) ELISA Kit
EIA07223Ca 1 Kit

Canine A-kinase anchor protein 10mitochondrial (AKAP10) ELISA Kit

Sign In for Pricing
View Details
Saliva - Charcoal Stripped x 3
MBS170584-01 1 L

Saliva - Charcoal Stripped x 3

Sign In for Pricing
View Details
Saliva - Charcoal Stripped x 3
MBS170584-02 5x 1 L

Saliva - Charcoal Stripped x 3

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans ksr-2 Polyclonal Antibody
MBS7146189 Inquire

Rabbit anti-Caenorhabditis elegans ksr-2 Polyclonal Antibody

Sign In for Pricing
View Details
DiagPoly™ Plain Fluorescent Polystyrene Particles, Green, 0.09 µm
DFOA-L021 15 mL

DiagPoly™ Plain Fluorescent Polystyrene Particles, Green, 0.09 µm

Sign In for Pricing
View Details