Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Myoglobin ELISA Kit
MBS8420747-01 1 Kit

Mouse Myoglobin ELISA Kit

Sign In for Pricing
View Details
Mouse Myoglobin ELISA Kit
MBS8420747-02 5x 1 Kit

Mouse Myoglobin ELISA Kit

Sign In for Pricing
View Details
MINDY1 (NM_018379) Human Recombinant Protein
TP316010 20 µg

MINDY1 (NM_018379) Human Recombinant Protein

Sign In for Pricing
View Details
Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit
MBS9501183-01 1 Kit

Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit
MBS9501183-02 5x 1 Kit

Phospho-BLNK (Tyr96) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) SULA Polyclonal Antibody
MBS7187845 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) SULA Polyclonal Antibody

Sign In for Pricing
View Details