Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP4 antibody
FNab02749 100 µg

ELP4 antibody

Sign In for Pricing
View Details
MonoMethyl-Histone H4 (Lys77) Recombinant Rabbit mAb
E43S43434 100 µL

MonoMethyl-Histone H4 (Lys77) Recombinant Rabbit mAb

Sign In for Pricing
View Details
Rat MDA (Malondialdehyde) ELISA Kit
EK247976 96 Well

Rat MDA (Malondialdehyde) ELISA Kit

Sign In for Pricing
View Details
Z-L-Phenylglycine extrapure, 99%
74157-01 10 g

Z-L-Phenylglycine extrapure, 99%

Sign In for Pricing
View Details
Z-L-Phenylglycine extrapure, 99%
74157-02 25 g

Z-L-Phenylglycine extrapure, 99%

Sign In for Pricing
View Details
Recombinant Jannaschia sp. NADH-quinone oxidoreductase subunit B (nuoB)
MBS1310981-01 0.02 mg (E-Coli)

Recombinant Jannaschia sp. NADH-quinone oxidoreductase subunit B (nuoB)

Sign In for Pricing
View Details