Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tris-Acetate Running Buffer for SDS-PAGE, 10x
EZB2007L-10x 500 mL

Tris-Acetate Running Buffer for SDS-PAGE, 10x

Sign In for Pricing
View Details
Recombinant Human Betacellulin Protein
261-CE-250 250 µg

Recombinant Human Betacellulin Protein

Sign In for Pricing
View Details
IL1RL1 Human, Sf9 Active
32-6411-2 2 µg

IL1RL1 Human, Sf9 Active

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae MLBr01503.1 Protein (aa 1-94)
VAng-Yyj2162-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Leprae MLBr01503.1 Protein (aa 1-94)

Sign In for Pricing
View Details
APBA3 3'UTR Luciferase Stable Cell Line
TU000928 1.0 mL

APBA3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (AP)
MBS6358528-01 0.2 mL

TRIM62, CT (TRIM62, Tripartite motif-containing protein 62) (AP)

Sign In for Pricing
View Details