Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM135 Recombinant Protein (Rat)
RP233510 100 µg

TMEM135 Recombinant Protein (Rat)

Sign In for Pricing
View Details
GYS1 Rabbit Monoclonal Antibody [Clone ID: 23GB4070]
TA425084S 20 µL

GYS1 Rabbit Monoclonal Antibody [Clone ID: 23GB4070]

Sign In for Pricing
View Details
Quick Step Human 8-iso prostaglandin F2 alpha (8isoPGF2a) elisa kit
QS2658Hu-01 48 Tests

Quick Step Human 8-iso prostaglandin F2 alpha (8isoPGF2a) elisa kit

Sign In for Pricing
View Details
Quick Step Human 8-iso prostaglandin F2 alpha (8isoPGF2a) elisa kit
QS2658Hu-02 96 Tests

Quick Step Human 8-iso prostaglandin F2 alpha (8isoPGF2a) elisa kit

Sign In for Pricing
View Details
C3orf39 (POMGNT2) Human siRNA Oligo Duplex (Locus ID 84892)
SR313716 1 Kit

C3orf39 (POMGNT2) Human siRNA Oligo Duplex (Locus ID 84892)

Sign In for Pricing
View Details
MAGEA9 Over-expression Lysate Product
GWB-E7D436 0.1 mg

MAGEA9 Over-expression Lysate Product

Sign In for Pricing
View Details