Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT7 antibody
FNab03325 100 µg

GALNT7 antibody

Sign In for Pricing
View Details
CEP55 CytoSection
TS425787P5 25 Slides

CEP55 CytoSection

Sign In for Pricing
View Details
PANK4 (h) -PR
sc-76046-PR 10 µM - 20 µL

PANK4 (h) -PR

Sign In for Pricing
View Details
Cytochrome b561 Antibody
MBS9418997-01 0.05 mL

Cytochrome b561 Antibody

Sign In for Pricing
View Details
Cytochrome b561 Antibody
MBS9418997-02 0.1 mL

Cytochrome b561 Antibody

Sign In for Pricing
View Details
Cytochrome b561 Antibody
MBS9418997-03 5x 0.1 mL

Cytochrome b561 Antibody

Sign In for Pricing
View Details