Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

p95 NBS1 (NBN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F11]
TA801215AM 100 µL

p95 NBS1 (NBN) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F11]

Sign In for Pricing
View Details
Recombinant Campylobacter Jejuni thiC Protein (aa 1-430)
VAng-Lsx6390-50gEcoli 50 µg (E. coli)

Recombinant Campylobacter Jejuni thiC Protein (aa 1-430)

Sign In for Pricing
View Details
Human ADAM28 MAb (Clone 2248A)
MAB9325-100 100 µg

Human ADAM28 MAb (Clone 2248A)

Sign In for Pricing
View Details
PLGLB1 (PLGLB2) Human Gene Knockout Kit (CRISPR)
KN422596 1 Kit

PLGLB1 (PLGLB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ndst2 3'UTR Luciferase Stable Cell Line
TU213817 1.0 mL

Ndst2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LCA5 (7C18) Mouse Monoclonal antibody
E28PE0871 100 µL

LCA5 (7C18) Mouse Monoclonal antibody

Sign In for Pricing
View Details