Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIX1L, ID (LIX1L, LIX1-like protein)
037824 200 µL

LIX1L, ID (LIX1L, LIX1-like protein)

Sign In for Pricing
View Details
Canine Transforming Growth factoβ1 (TGF-β1) ELISA Kit
OM626285 96 Tests

Canine Transforming Growth factoβ1 (TGF-β1) ELISA Kit

Sign In for Pricing
View Details
HaloTag O2 Tobramycin
451702-01 1 mg

HaloTag O2 Tobramycin

Sign In for Pricing
View Details
HaloTag O2 Tobramycin
451702-02 2.5 mg

HaloTag O2 Tobramycin

Sign In for Pricing
View Details
USP40 Mouse Monoclonal Antibody [Clone ID: OTI4F7]
TA809863 100 µL

USP40 Mouse Monoclonal Antibody [Clone ID: OTI4F7]

Sign In for Pricing
View Details
Mouse Osterix (OSX) ELISA Kit
RDR-OSX-Mu-01 96 Tests

Mouse Osterix (OSX) ELISA Kit

Sign In for Pricing
View Details