Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RING1 Protein Vector (Human) (pPM-C-His)
PV035296 500 ng

RING1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
HAMP Protein Vector (Mouse) (pPB-N-His)
PV187855 500 ng

HAMP Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CAMP-dependent protein Kinase type II-α regulatory subunit (PRKAR2A) Porcine ELISA Kit
C0942 96 Tests

CAMP-dependent protein Kinase type II-α regulatory subunit (PRKAR2A) Porcine ELISA Kit

Sign In for Pricing
View Details
HVEM Antibody
E38QA2278 100 µL

HVEM Antibody

Sign In for Pricing
View Details
Porcine Alpha-mannosidase 2C1 (MAN2C1) ELISA Kit
MBS7207182-01 48 Well

Porcine Alpha-mannosidase 2C1 (MAN2C1) ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-mannosidase 2C1 (MAN2C1) ELISA Kit
MBS7207182-02 96 Well

Porcine Alpha-mannosidase 2C1 (MAN2C1) ELISA Kit

Sign In for Pricing
View Details