Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLITRK4 siRNA (Human)
MBS8213342-01 15 nmol

SLITRK4 siRNA (Human)

Sign In for Pricing
View Details
SLITRK4 siRNA (Human)
MBS8213342-02 30 nmol

SLITRK4 siRNA (Human)

Sign In for Pricing
View Details
SLITRK4 siRNA (Human)
MBS8213342-03 5x 30 nmol

SLITRK4 siRNA (Human)

Sign In for Pricing
View Details
LILRB1 (NM_001081637) Human Tagged Lenti ORF Clone
RC224547L2 10 µg

LILRB1 (NM_001081637) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human Secreted Phospholipase A2-IIE
MBS142468-01 0.002 mg

Recombinant Human Secreted Phospholipase A2-IIE

Sign In for Pricing
View Details
Recombinant Human Secreted Phospholipase A2-IIE
MBS142468-02 0.01 mg

Recombinant Human Secreted Phospholipase A2-IIE

Sign In for Pricing
View Details