Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhesus macaque / Cynomolgus Complement Factor D / CFD Protein, His Tag (active enzyme)
CFD-R52H3-1mg 1 mg

Rhesus macaque / Cynomolgus Complement Factor D / CFD Protein, His Tag (active enzyme)

Sign In for Pricing
View Details
PLEKHM1 (Pleckstrin Homology Domain-containing Family M Member 1, PH Domain-containing Family M Member 1, 162kD Adapter Protein, AP162, KIAA0356, OPTB6) (AP)
MBS6133004-01 0.1 mL

PLEKHM1 (Pleckstrin Homology Domain-containing Family M Member 1, PH Domain-containing Family M Member 1, 162kD Adapter Protein, AP162, KIAA0356, OPTB6) (AP)

Sign In for Pricing
View Details
PLEKHM1 (Pleckstrin Homology Domain-containing Family M Member 1, PH Domain-containing Family M Member 1, 162kD Adapter Protein, AP162, KIAA0356, OPTB6) (AP)
MBS6133004-02 5x 0.1 mL

PLEKHM1 (Pleckstrin Homology Domain-containing Family M Member 1, PH Domain-containing Family M Member 1, 162kD Adapter Protein, AP162, KIAA0356, OPTB6) (AP)

Sign In for Pricing
View Details
Lentiviral mouse Bloc1s6 shRNA (UAS) - Lentiviral mouse Bloc1s6 shRNA (UAS, GFP) (100)
GTR15197613 1 Vial

Lentiviral mouse Bloc1s6 shRNA (UAS) - Lentiviral mouse Bloc1s6 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2) Antibody (HRP)
abx315107-01 20 µg

Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2) Antibody (HRP)

Sign In for Pricing
View Details
Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2) Antibody (HRP)
abx315107-02 50 µg

Diacylglycerol-O-Acyltransferase Homolog 2 (DGAT2) Antibody (HRP)

Sign In for Pricing
View Details