Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF128 Antibody; Biotin conjugated
MBS7002409-01 0.05 mg

RNF128 Antibody; Biotin conjugated

Sign In for Pricing
View Details
RNF128 Antibody; Biotin conjugated
MBS7002409-02 0.1 mg

RNF128 Antibody; Biotin conjugated

Sign In for Pricing
View Details
RNF128 Antibody; Biotin conjugated
MBS7002409-03 5x 0.1 mg

RNF128 Antibody; Biotin conjugated

Sign In for Pricing
View Details
HOXC5 Human shRNA Plasmid Kit (Locus ID 3222)
TR304057 1 Kit

HOXC5 Human shRNA Plasmid Kit (Locus ID 3222)

Sign In for Pricing
View Details
1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine, Hydrochloride
sc-206178A 250 mg

1-Methyl-4-phenyl-1,2,3,6-tetrahydropyridine, Hydrochloride

Sign In for Pricing
View Details
RAB5A ORF Vector (Human) (pORF)
ORF008512 1.0 µg DNA

RAB5A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details