Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSP27/HSPB1, Human (His)

The HSP27/HSPB1 protein is a small heat shock protein that acts as a molecular chaperone, possibly maintaining denatured proteins in a foldable state. In addition to its chaperone role, it crucially enhances stress resistance and contributes to actin organization. HSP27/HSPB1 Protein, Human (His) is the recombinant human-derived HSP27/HSPB1 protein, expressed by E. coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

HSP27/HSPB1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hsp27-hspb1-protein-human-his.html

Purity

96.00

Smiles

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Molecular Formula

3315 (Gene_ID) P04792/NP_001531.1 (M1-K205) (Accession)

Molecular Weight

Approximately 26-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMC1 Human shRNA Plasmid Kit (Locus ID 117531)

TR301062 1 Kit

TMC1 Human shRNA Plasmid Kit (Locus ID 117531)

Sign In for Pricing

Recombinant Human PCDH7 Protein, C-Fc

MBS1579398-01 0.1 mg

Recombinant Human PCDH7 Protein, C-Fc

Sign In for Pricing

Recombinant Human PCDH7 Protein, C-Fc

MBS1579398-02 1 mg

Recombinant Human PCDH7 Protein, C-Fc

Sign In for Pricing

Recombinant Human PCDH7 Protein, C-Fc

MBS1579398-03 5x 1 mg

Recombinant Human PCDH7 Protein, C-Fc

Sign In for Pricing

HMOX2, NT (HMOX2, HO2, Heme oxygenase 2) (FITC) discontinued

036652-FITC 200 µL

HMOX2, NT (HMOX2, HO2, Heme oxygenase 2) (FITC) discontinued

Sign In for Pricing

MAP Kinase p44/42, phosphorylated (Thr185/Tyr187) (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1, PRKM2 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, p44-ERK1, ERK1, PRKM3)

M2352-10D 100 µL

MAP Kinase p44/42, phosphorylated (Thr185/Tyr187) (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1, PRKM2 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, p44-ERK1, ERK1, PRKM3)

Sign In for Pricing