What is the catalog number for FGF-18, Human?

The catalog number for FGF-18, Human is HY-P7123.

What sizes are available for FGF-18, Human?

FGF-18, Human is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg.

How many pack sizes does FGF-18, Human come in?

FGF-18, Human is available in 4 different pack sizes.

Is FGF-18, Human in stock?

FGF-18, Human is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures FGF-18, Human?

FGF-18, Human is manufactured by QuantiMol.

What is the estimated delivery time for FGF-18, Human?

Estimated delivery time for FGF-18, Human is approximately 15 business day(s), depending on your location.

FGF-18, Human

FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

Product Specifications

Product Name Alternative

FGF-18 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-human.html

Purity

95.00

Smiles

AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

Molecular Formula

8817 (Gene_ID) O76093 (A27-R199) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32 (7) :923-7.|[2]Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37 (2) :1235-1242.