Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-18, Human

FGF-18 Protein, Human is a heparin-binding polypeptide growth factor, involved in cartilage growth, maturation and the development of functional cartilage and bone tissue.

Product Specifications

Product Name Alternative

FGF-18 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-18-protein-human.html

Purity

95.00

Smiles

AEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR

Molecular Formula

8817 (Gene_ID) O76093 (A27-R199) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Barr L, et al. The effect of recombinant human fibroblast growth factor-18 on articular cartilage following single impact load. J Orthop Res. 2014 Jul;32 (7) :923-7.|[2]Chen T, et al. Fibroblast growth factor 18 promotes proliferation and migration of H460 cells via the ERK and p38 signaling pathways. Oncol Rep. 2017 Feb;37 (2) :1235-1242.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCRLA Antibody
MBS9434742-01 0.1 mL

FCRLA Antibody

Sign In for Pricing
View Details
FCRLA Antibody
MBS9434742-02 5x 0.1 mL

FCRLA Antibody

Sign In for Pricing
View Details
NM23A Rabbit mAb
MBS9470685-01 0.05 mL

NM23A Rabbit mAb

Sign In for Pricing
View Details
NM23A Rabbit mAb
MBS9470685-02 0.1 mL

NM23A Rabbit mAb

Sign In for Pricing
View Details
NM23A Rabbit mAb
MBS9470685-03 5x 0.1 mL

NM23A Rabbit mAb

Sign In for Pricing
View Details
RAB8A Recombinant Rabbit mAb
ARM1037-01 30 µL

RAB8A Recombinant Rabbit mAb

Sign In for Pricing
View Details