Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neuronal pentraxin-1 (NPTX1), partial

Product Specifications

Product Name Alternative

(NP1) (Neuronal pentraxin I) (NP-I)

Abbreviation

Recombinant Human NPTX1 protein, partial

Gene Name

NPTX1

UniProt

Q15818

Expression Region

88-227aa

Organism

Homo sapiens (Human)

Target Sequence

RCESQSTLDPGAGEARAGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSRVNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDK

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

May be involved in mediating uptake of synaptic material during synapse remodeling or in mediating the synaptic clustering of AMPA glutamate receptors at a subset of excitatory synapses.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.5 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-500 1x 500 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL
BNC680003-500 1x 500 µL

CD45RO (UCHL-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL
BNC740782-100 1x 100 µL

Bcl-2 (BCL2/782), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (DE-K18), CF740 conjugate, 0.1mg/mL
BNC740563-100 1x 100 µL

Cytokeratin 18 (DE-K18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF405S conjugate, 0.1mg/mL
BNC040637-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details