Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Respiratory nitrate reductase 1 alpha chain (narG), partial

Product Specifications

Product Name Alternative

(Nitrate reductase A subunit alpha) (Quinol-nitrate oxidoreductase subunit alpha)

Abbreviation

Recombinant E.coli narG protein, partial

Gene Name

NarG

UniProt

P09152

Expression Region

1-110aa

Organism

Escherichia coli (strain K12)

Target Sequence

MSKFLDRFRYFKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

The nitrate reductase enzyme complex allows E.coli to use nitrate as an electron acceptor during anaerobic growth. The alpha chain is the actual site of nitrate reduction.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.5 kDa

References & Citations

"Basis of recognition between the NarJ chaperone and the N-terminus of the NarG subunit from Escherichia coli nitrate reductase." Zakian S., Lafitte D., Vergnes A., Pimentel C., Sebban-Kreuzer C., Toci R., Claude J.B., Guerlesquin F., Magalon A. FEBS J. 277:1886-1895 (2010)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm17660 (NM_001163772) Mouse Tagged ORF Clone
MG221095 10 µg

Gm17660 (NM_001163772) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Spectrin beta II antibody
STJ95746 200 µl

Anti-Spectrin beta II antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)
MBS7039753-01 0.02 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)
MBS7039753-02 0.1 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)
MBS7039753-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A (YCL021W-A)

Sign In for Pricing
View Details
Chromogranin A (Chromogranin-A, CgA, Pituitary Secretory Protein I, SP-I, CHGA) (AP) discontinued
124983-AP 100 µL

Chromogranin A (Chromogranin-A, CgA, Pituitary Secretory Protein I, SP-I, CHGA) (AP) discontinued

Sign In for Pricing
View Details