Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chromosome X open reading frame, human CXorf65 (Il2rg), partial

Product Specifications

Product Name Alternative

Interleukin 2 receptor, gamma

Abbreviation

Recombinant Rat Il2rg protein, partial

Gene Name

Il2rg

UniProt

Q68FU6

Expression Region

1-262aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MLKPLLPSRSFLLLQLLLLRVGWSSKVLMSSGNEDTKSDLLLTSMDLKHLSVPTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTMHYRYKGSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAEQKLNLQNLVIPWAPENLTLYNLSESQVELRWKSRYIERCLQYLVQYRSNRDRSWTEQIVDHEPRFSLPSVDEQKLYTFRVRSRFNPICGSTQQWSKWSQPIHWGSHTAEENPSLFALEA

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details