M-CSF, Rat
M-CSF Protein, Rat is a pro-inflammatory cytokine, binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes.
Product Specifications
Product Name Alternative
M-CSF Protein, Rat, Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/m-csf-protein-rat.html
Purity
96.00
Smiles
MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP
Molecular Formula
78965 (Gene_ID) Q8JZQ0-1 (E33-P186) (Accession)
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
