Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Rat

M-CSF Protein, Rat is a pro-inflammatory cytokine, binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes.

Product Specifications

Product Name Alternative

M-CSF Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-rat.html

Purity

96.00

Smiles

MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP

Molecular Formula

78965 (Gene_ID) Q8JZQ0-1 (E33-P186) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human LURAP1L shRNA (UAS) - Lentiviral human LURAP1L shRNA (UAS) (100)
GTR15123450 1 Vial

Lentiviral human LURAP1L shRNA (UAS) - Lentiviral human LURAP1L shRNA (UAS) (100)

Ask
View Details
PSMA7 Protein (N-His, Human)
P507485 100 µg

PSMA7 Protein (N-His, Human)

Ask
View Details
AMPK (A2/B2/G2), Recombinant, Human, His-Tag (Subunit A2: PRKAA2, AMPK, AMPK2, PRKAA Subunit B2: PRKAB2, MGC61468 Subunit G2: PRKAG2, AAKG, CMH6, WPWS, AAKG2, H91620p) discontinued
499787 10 µg

AMPK (A2/B2/G2), Recombinant, Human, His-Tag (Subunit A2: PRKAA2, AMPK, AMPK2, PRKAA Subunit B2: PRKAB2, MGC61468 Subunit G2: PRKAG2, AAKG, CMH6, WPWS, AAKG2, H91620p) discontinued

Ask
View Details
SCDA w/0.5% Soya Lecithin & 4% Polysorbate 80 (Twin Pack)
M2181-500G 500 g

SCDA w/0.5% Soya Lecithin & 4% Polysorbate 80 (Twin Pack)

Ask
View Details
Tctex1d2 Rat shRNA Plasmid (Locus ID 498095)
TR707568 1 Kit

Tctex1d2 Rat shRNA Plasmid (Locus ID 498095)

Ask
View Details
Casp1 (NM_012762) Rat Tagged ORF Clone Lentiviral Particle
RR210506L3V 200 µL

Casp1 (NM_012762) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details