What is the catalog number for M-CSF, Rat?

The catalog number for M-CSF, Rat is HY-P7386.

What sizes are available for M-CSF, Rat?

M-CSF, Rat is available in the following size(s): 2 µg, 10 µg, 50 µg, 100 µg, 500 µg, 1 mg.

How many pack sizes does M-CSF, Rat come in?

M-CSF, Rat is available in 6 different pack sizes.

Is M-CSF, Rat in stock?

M-CSF, Rat is currently made to order / not held in immediate stock. Contact us for lead time.

Who manufactures M-CSF, Rat?

M-CSF, Rat is manufactured by QuantiMol.

What is the estimated delivery time for M-CSF, Rat?

Estimated delivery time for M-CSF, Rat is approximately 15 business day(s), depending on your location.

M-CSF, Rat

M-CSF Protein, Rat is a pro-inflammatory cytokine, binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes.

Product Specifications

Product Name Alternative

M-CSF Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-rat.html

Purity

96.00

Smiles

MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP

Molecular Formula

78965 (Gene_ID) Q8JZQ0-1 (E33-P186) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.