Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M-CSF, Rat

M-CSF Protein, Rat is a pro-inflammatory cytokine, binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts which are important in the destruction of bone and cartilage and in the periarticular osteoporotic changes.

Product Specifications

Product Name Alternative

M-CSF Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/m-csf-protein-rat.html

Purity

96.00

Smiles

MEVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMRFKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKDWNIFSKNCNDSLAKCSSRDVVTKP

Molecular Formula

78965 (Gene_ID) Q8JZQ0-1 (E33-P186) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Zfp385b (NM_178723) Mouse Recombinant Protein
TP518990 20 µg

Zfp385b (NM_178723) Mouse Recombinant Protein

Ask
View Details
GluR2 (Glutamate Receptor) (Biotin)
G3500-13-Biotin 100 µL

GluR2 (Glutamate Receptor) (Biotin)

Ask
View Details
Angiotensinogen Protein, Mouse, Recombinant (His Tag)
PM52669M2 100 µg

Angiotensinogen Protein, Mouse, Recombinant (His Tag)

Ask
View Details
Rabbit Polyclonal Collagen VI alpha 3 Antibody [mFluor Violet 610 SE]
NBP2-97125MFV610 0.1 mL

Rabbit Polyclonal Collagen VI alpha 3 Antibody [mFluor Violet 610 SE]

Ask
View Details
ARHGEF9 polyclonal antibody
BS65185-01 50 µL

ARHGEF9 polyclonal antibody

Ask
View Details
ARHGEF9 polyclonal antibody
BS65185-02 100 µL

ARHGEF9 polyclonal antibody

Ask
View Details