Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLXNA1, Human (His)

PLXNA1 protein serves as a co-receptor for SEMA3A, SEMA3C, SEMA3F and SEMA6D, achieving cytoskeletal remodeling and signaling through three types of signaling proteins. PLXNA1 Protein, Human (His) is the recombinant human-derived PLXNA1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

PLXNA1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/plxna1-protein-human-his.html

Smiles

LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGGIERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL

Molecular Formula

5361 (Gene_ID) Q9UIW2 (L986-L1152) (Accession)

Molecular Weight

Approximately 22.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCK3 (COQ8A) (NM_020247) Human Over-expression Lysate
LC402769 20 µg

ADCK3 (COQ8A) (NM_020247) Human Over-expression Lysate

Sign In for Pricing
View Details
MemBrite® Fix 660/770 Cell Surface Staining Kit, 100 Reactions
#30098-T 1 Kit

MemBrite® Fix 660/770 Cell Surface Staining Kit, 100 Reactions

Sign In for Pricing
View Details
FGF13 (NM_004114) Human Over-expression Lysate
LY418207 100 µg

FGF13 (NM_004114) Human Over-expression Lysate

Sign In for Pricing
View Details
PYCR3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]
TA502032AM 100 µL

PYCR3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]

Sign In for Pricing
View Details
Human CSNK2A3 activation kit by CRISPRa
GA116982 1 Kit

Human CSNK2A3 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Fam3a activation kit by CRISPRa
GA206694 1 Kit

Mouse Fam3a activation kit by CRISPRa

Sign In for Pricing
View Details