Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17A (IL17A) (Active)

Product Specifications

Product Name Alternative

Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17

Abbreviation

Recombinant Human IL17A protein (Active)

Gene Name

IL17A

UniProt

Q16552

Expression Region

24-155aa

Organism

Homo sapiens (Human)

Target Sequence

GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is 1-7 ng/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Ligand for IL17RA and IL17RC

Molecular Weight

15.26 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F16B1 rabbit pAb Antibody
orb2305355-01 50 µL

F16B1 rabbit pAb Antibody

Sign In for Pricing
View Details
F16B1 rabbit pAb Antibody
orb2305355-02 100 µL

F16B1 rabbit pAb Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 2 (IL2)
TRV-0032583-01 20 µL

Monoclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 2 (IL2)
TRV-0032583-02 100 µL

Monoclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 2 (IL2)
TRV-0032583-03 200 µL

Monoclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 2 (IL2)
TRV-0032583-04 1 mL

Monoclonal Antibody to Interleukin 2 (IL2)

Sign In for Pricing
View Details