Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus agalactiae serotype III Holo-[acyl-carrier-protein] synthase (acpS)

Product Specifications

Product Name Alternative

4'-phosphopantetheinyl transferase AcpS

Abbreviation

Recombinant Streptococcus agalactiae serotype III acpS protein

Gene Name

AcpS

UniProt

P63471

Expression Region

1-119aa

Organism

Streptococcus agalactiae serotype III (strain NEM316)

Target Sequence

MIVGHGIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSDDKGAPLITKEPFNGKSFVSISHSGNYAQASVILEEEK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.7 kDa

References & Citations

"Genome sequence of Streptococcus agalactiae, a pathogen causing invasive neonatal disease." Glaser P., Rusniok C., Buchrieser C., Chevalier F., Frangeul L., Msadek T., Zouine M., Couve E., Lalioui L., Poyart C., Trieu-Cuot P., Kunst F. Mol. Microbiol. 45:1499-1513 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-500 1x 500 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-100 1x 100 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL
BNC880304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF640R conjugate, 0.1mg/mL
BNC401824-500 1x 500 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details