Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Newcastle disease virus Phosphoprotein (P)

Product Specifications

Product Name Alternative

Protein P

Abbreviation

Recombinant Newcastle disease virus Phosphoprotein

Gene Name

P

UniProt

Q9DLD6

Expression Region

1-395aa

Organism

Newcastle disease virus (strain Chicken/United States/B1/48) (NDV)

Target Sequence

MATFTDAEIDELFETSGTVIDNIITAQGKPAETVGRSAIPQGKTKVLSAAWEKHGSIQPPASQDNPDRQDRSDKQPSTPEQTTPHDSPPATSADQPPTQATDEAVDTQLRTGASNSLLLMLDKLSNKSSNAKKGPWSSPQEGNHQRPTQQQGSQPSRGNSQERPQNQVKAAPGNQGTDVNTAYHGQWEESQLSAGATPHGLRSKQSQNNTPVSADHFHPPVDFVQAMMSIMEGISQRVSKVAYQVDLVFKQTSSIPMMGSEIQQLKTFVAVMEANLGMMKILDPGCANISSLSDLRAVARSHPVLVSGPGDPSPYVIQGGEMALNKLSQPVPHPSELIKPATACGPDIGVERDTVRALIMSRPMHPSSSAKLLSKLDAAGSIEEIRKIKRLALNG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Essential component of the RNA polymerase transcription and replication complex. Binds the viral ribonucleocapsid and positions the L polymerase on the template. ; Acts as a chaperone for newly synthesized free N protein, so-called N (0) . Stabilizes the L protein upon binding it.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rpl21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7047106 1.0 µg DNA

Rpl21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Recombinant Human ANGPT2 Protein, His Tag
KMH510 50 µg

Recombinant Human ANGPT2 Protein, His Tag

Sign In for Pricing
View Details
IMPDH1 (Inosine-5'-monophosphate Dehydrogenase 1, IMP Dehydrogenase 1, IMPD 1, IMPDH 1, IMPDH-I, IMPD1) (APC)
128497-APC 100 µL

IMPDH1 (Inosine-5'-monophosphate Dehydrogenase 1, IMP Dehydrogenase 1, IMPD 1, IMPDH 1, IMPDH-I, IMPD1) (APC)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) vma2 Polyclonal Antibody
MBS7138238 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) vma2 Polyclonal Antibody

Sign In for Pricing
View Details
GRK1 (G-Protein-coupled Receptor Kinase 1, GPRK1, Rhodopsin Kinase, RHOK, RK) (HRP)
127548-HRP 100 µL

GRK1 (G-Protein-coupled Receptor Kinase 1, GPRK1, Rhodopsin Kinase, RHOK, RK) (HRP)

Sign In for Pricing
View Details
IgG3, Mouse
MBS654966-01 1 mg

IgG3, Mouse

Sign In for Pricing
View Details