Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human BRCA1-associated protein (BRAP), partial

Product Specifications

Abbreviation

Recombinant Human BRAP protein, partial

Gene Name

BRAP

UniProt

J3KNN7

Expression Region

294-346aa

Organism

Homo sapiens (Human)

Target Sequence

ENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQLTNHRVWDYAGDNYVHR

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CABP4 activation kit by CRISPRa
GA111335 1 Kit

Human CABP4 activation kit by CRISPRa

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL
BNC740245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left upper lobe
CS712517 5x 5 µm

Tissue FFPE Sections, Lung: left upper lobe

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (DSD/958), CF740 conjugate, 0.1mg/mL
BNC740958-500 1x 500 µL

Double Stranded DNA (dsDNA) (DSD/958), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl10 Mouse Gene Knockout Kit (CRISPR)
KN502093 1 Kit

Bcl10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details