Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOG, Mouse (His)

MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication.It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes.MOG Protein, Mouse (His) is the recombinant mouse-derived MOG protein, expressed by E.coli , with C-His labeled tag.

Product Specifications

Product Name Alternative

MOG Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mog-protein-mouse-his.html

Purity

96.00

Smiles

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Molecular Formula

17441 (Gene_ID) Q61885 (G29-T156) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem119 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46874114 3x 1.0 µg

Tmem119 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
15-Epi-Danshenol-A
T125334-01 1 mg

15-Epi-Danshenol-A

Sign In for Pricing
View Details
15-Epi-Danshenol-A
T125334-02 5 mg

15-Epi-Danshenol-A

Sign In for Pricing
View Details
TSC2 Antibody
F47584-0.4ML 0.4 mL

TSC2 Antibody

Sign In for Pricing
View Details
CNPY2, CT (CNPY2, MSAP, TMEM4, ZSIG9, Protein canopy homolog 2, MIR-interacting saposin-like protein, Putative secreted protein Zsig9, Transmembrane protein 4) (MaxLight 550) discontinued
034054-ML550 100 µL

CNPY2, CT (CNPY2, MSAP, TMEM4, ZSIG9, Protein canopy homolog 2, MIR-interacting saposin-like protein, Putative secreted protein Zsig9, Transmembrane protein 4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
EXOSC2 siRNA Oligos set (Human)
19574171 3x 5 nmol

EXOSC2 siRNA Oligos set (Human)

Sign In for Pricing
View Details