Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endoplasmic reticulum metallopeptidase 1 (ERMP1), partial

Product Specifications

Product Name Alternative

(Felix-ina)

Abbreviation

Recombinant Human ERMP1 protein, partial

Gene Name

ERMP1

UniProt

Q7Z2K6

Expression Region

85-399aa

Organism

Homo sapiens (Human)

Target Sequence

RTLVQLSLQQLVLRGAAGHRGEFDALQARDYLEHITSIGPRTTGSPENEILTVHYLLEQIKLIEVQSNSLHKISVDVQRPTGSFSIDFLGGFTSYYDNITNVVVKLEPRDGAQHAVLANCHFDSVANSPGASDDAVSCSVMLEVLRVLSTSSEALHHAVIFLFNGAEENVLQASHGFITQHPWASLIRAFINLEAAGVGGKELVFQTGPENPWLVQAYVSAAKHPFASVVAQEVFQSGIIPSDTDFRIYRDFGNIPGIDLAFIENGYIYHTKYDTADRILTDSIQRAGDNILAVLKHLATSDMLAAASKYRHGNM

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Within the ovary, required for the organization of somatic cells and oocytes into discrete follicular structures.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.4 kDa

References & Citations

"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC) ." The MGC Project Team Genome Res. 14:2121-2127 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf25 (FAM219A) (NM_001184945) Human Over-expression Lysate
LC432602 20 µg

C9orf25 (FAM219A) (NM_001184945) Human Over-expression Lysate

Sign In for Pricing
View Details
Purified Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179A-01 25 µg

Purified Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
Purified Anti-Mouse CD24 Antibody[M1/69]
E-AB-F1179A-02 100 µg

Purified Anti-Mouse CD24 Antibody[M1/69]

Sign In for Pricing
View Details
HACE1 Mouse Monoclonal Antibody [Clone ID: OTI6H8]
CF810071 100 µg

HACE1 Mouse Monoclonal Antibody [Clone ID: OTI6H8]

Sign In for Pricing
View Details
Recombinant Rat Chymase protein (His tag)
PDER100207-01 20 µg

Recombinant Rat Chymase protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat Chymase protein (His tag)
PDER100207-02 100 µg

Recombinant Rat Chymase protein (His tag)

Sign In for Pricing
View Details