Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Microtubule-associated protein tau (MAPT) , partial

Product Specifications

CAS Number

9000-83-3

Gene Name

MAPT

UniProt

P10636

Expression Region

297-391aa

Organism

Homo sapiens

Target Sequence

IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Field of Research

Neuroscience

Assay Type

Developed Protein

Relevance

Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by TAU/MAPT localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Length

Partial

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL
BNC402078-500 1x 500 µL

TCL1 (T-Cell Marker) (TCL1/2078), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF568 conjugate, 0.1mg/mL
BNC682550-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/2550R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), 0.2mg/mL
BNUB0391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), 0.2mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL
BNC680421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL
BNC740393-500 1x 500 µL

Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details