Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Human (GST)

The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (GST) is the recombinant human-derived TDGF1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-human-gst.html

Smiles

GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Molecular Formula

6997 (Gene_ID) P13385 (G32-D150) (Accession)

Molecular Weight

40.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Phenyl-5-(pyridin-2-yl)-2(1H)-pyridone-d5
TRC-P336752-1MG 1 mg

1-Phenyl-5-(pyridin-2-yl)-2(1H)-pyridone-d5

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA812558AM 100 µL

TIM 3 (HAVCR2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]

Sign In for Pricing
View Details
Transfer Pipettes
P4122-01 500 Units/Pack

Transfer Pipettes

Sign In for Pricing
View Details
Meldrum’s Acid-13C3
TRC-M215253-50MG 50 mg

Meldrum’s Acid-13C3

Sign In for Pricing
View Details
WFS1 (NM_001145853) Human Over-expression Lysate
LC429034 20 µg

WFS1 (NM_001145853) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS636393 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details