Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1, Human (GST)

The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (GST) is the recombinant human-derived TDGF1 protein, expressed by E. coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

TDGF1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tdgf1-protein-human-gst.html

Smiles

GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Molecular Formula

6997 (Gene_ID) P13385 (G32-D150) (Accession)

Molecular Weight

40.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF167 (ZKSCAN7) activation kit by CRISPRa
GA111039 1 Kit

Human ZNF167 (ZKSCAN7) activation kit by CRISPRa

Sign In for Pricing
View Details
ExoBriteTM R-PE IgG1 Isotype Control Flow Antibody (25 tests)
P008-RPE-125 1x 125 µL

ExoBriteTM R-PE IgG1 Isotype Control Flow Antibody (25 tests)

Sign In for Pricing
View Details
Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit
E-EL-H6081-01 24 Tests

Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit

Sign In for Pricing
View Details
Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit
E-EL-H6081-02 48 Tests

Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit

Sign In for Pricing
View Details
Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit
E-EL-H6081-03 96 Tests

Human PTX 3/TSG-14 (Pentraxin 3) ELISA Kit

Sign In for Pricing
View Details
Cesium Iodide
TRC-C280018-500MG 500 mg

Cesium Iodide

Sign In for Pricing
View Details