IL-4, Cynomolgus (P.pastoris, His)
IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived IL-4 protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
IL-4 Protein, Cynomolgus (P.pastoris, His), Cynomolgus, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-4-protein-cynomolgus-p-pastoris-his.html
Smiles
HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Molecular Formula
107130068 (Gene_ID) P79339-1 (H25-S153) (Accession)
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
