Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XII/F12, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/f12-coagulation-factor-xii-pig-p-pastoris-his.html

Smiles

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Formula

397474 (Gene_ID) O97507 (I20-R371) (Accession)

Molecular Weight

41.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC3 Human Knockdown Lysate
LY300439 100 µg

TACC3 Human Knockdown Lysate

Sign In for Pricing
View Details
GPR55 (NM_005683) Human Tagged ORF Clone Lentiviral Particle
RC207570L2V 200 µL

GPR55 (NM_005683) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Troponin C, Skeletal Muscle (TNNC2) Protein
abx069485-01 10 µg

Human Troponin C, Skeletal Muscle (TNNC2) Protein

Sign In for Pricing
View Details
Human Troponin C, Skeletal Muscle (TNNC2) Protein
abx069485-02 50 µg

Human Troponin C, Skeletal Muscle (TNNC2) Protein

Sign In for Pricing
View Details
Human Troponin C, Skeletal Muscle (TNNC2) Protein
abx069485-03 100 µg

Human Troponin C, Skeletal Muscle (TNNC2) Protein

Sign In for Pricing
View Details
Human Troponin C, Skeletal Muscle (TNNC2) Protein
abx069485-04 200 µg

Human Troponin C, Skeletal Muscle (TNNC2) Protein

Sign In for Pricing
View Details