Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XII/F12, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/f12-coagulation-factor-xii-pig-p-pastoris-his.html

Smiles

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Formula

397474 (Gene_ID) O97507 (I20-R371) (Accession)

Molecular Weight

41.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nox3 Mouse siRNA Oligo Duplex (Locus ID 224480)
SR417825 1 Kit

Nox3 Mouse siRNA Oligo Duplex (Locus ID 224480)

Sign In for Pricing
View Details
HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (MaxLight 490)
128123-ML490 100 µL

HSPA13 (Heat Shock 70kD Protein 13, Stress 70 Protein Chaperone Microsome-associated 60kD Protein, Microsomal Stress 70 Protein ATPase Core, STCH) (MaxLight 490)

Sign In for Pricing
View Details
Rabbit Polyclonal rpmB/L28 Antibody [CoraFluor 1]
NBP3-23513CL1 0.1 mL

Rabbit Polyclonal rpmB/L28 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
CALCRL Antibody (Center)
MBS9208627-01 0.08 mL

CALCRL Antibody (Center)

Sign In for Pricing
View Details
CALCRL Antibody (Center)
MBS9208627-02 0.4 mL

CALCRL Antibody (Center)

Sign In for Pricing
View Details
CALCRL Antibody (Center)
MBS9208627-03 5x 0.4 mL

CALCRL Antibody (Center)

Sign In for Pricing
View Details