Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XII/F12, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/f12-coagulation-factor-xii-pig-p-pastoris-his.html

Smiles

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Formula

397474 (Gene_ID) O97507 (I20-R371) (Accession)

Molecular Weight

41.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibulin 1 Recombinant Protein Antigen
NBP1-84726PEP 0.1 mL

Fibulin 1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit Polyclonal MCHR1 Antibody
NLS1539 0.05 mL

Rabbit Polyclonal MCHR1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal FKBP14 Antibody (18E2) [Alexa Fluor 488]
NBP2-59474AF488 0.1 mL

Mouse Monoclonal FKBP14 Antibody (18E2) [Alexa Fluor 488]

Sign In for Pricing
View Details
Cyp2j8 (NM_001104927) Mouse Tagged ORF Clone
MR221810 10 µg

Cyp2j8 (NM_001104927) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PTac-GST-CHMP5 Plasmid
PVT79181 2 µg

PTac-GST-CHMP5 Plasmid

Sign In for Pricing
View Details
CSGLCAT (CHPF2) (NM_019015) Human Over-expression Lysate
LS054480-100ug 100 µg

CSGLCAT (CHPF2) (NM_019015) Human Over-expression Lysate

Sign In for Pricing
View Details