Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XII/F12, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/f12-coagulation-factor-xii-pig-p-pastoris-his.html

Smiles

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Formula

397474 (Gene_ID) O97507 (I20-R371) (Accession)

Molecular Weight

41.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KCTD5 Antibody (OTI3C8) [mFluor Violet 450 SE]
NBP2-71955MFV450 0.1 mL

Mouse Monoclonal KCTD5 Antibody (OTI3C8) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
PF-3845
MBS578618 Inquire

PF-3845

Sign In for Pricing
View Details
AHNAK Protein (N-His, Human)
P500363 100 µg

AHNAK Protein (N-His, Human)

Sign In for Pricing
View Details
Lentiviral human FRRS1 sgRNA gene knockout kit - Lentiviral human FRRS1 sgRNA gene knockout kit (100)
GTR15389182 1 Vial

Lentiviral human FRRS1 sgRNA gene knockout kit - Lentiviral human FRRS1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Melanoma, gp100 (Melanoma Associated Antigen) discontinued
M2869-01 100 µL

Melanoma, gp100 (Melanoma Associated Antigen) discontinued

Sign In for Pricing
View Details
BAIAP2 Antibody, HRP conjugated
A71616-50UG 50 µg

BAIAP2 Antibody, HRP conjugated

Sign In for Pricing
View Details