Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XII/F12, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/f12-coagulation-factor-xii-pig-p-pastoris-his.html

Smiles

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Formula

397474 (Gene_ID) O97507 (I20-R371) (Accession)

Molecular Weight

41.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG, H&L, X-Adsorbed (TRITC)
I1903-06S 1 mg

IgG, H&L, X-Adsorbed (TRITC)

Sign In for Pricing
View Details
BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 650)
MBS6277908-01 0.1 mL

BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 650)

Sign In for Pricing
View Details
BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 650)
MBS6277908-02 5x 0.1 mL

BCL11B, ID (BCL11B, CTIP2, RIT1, B Cell lymphoma/leukemia 11B, B Cell CLL/lymphoma 11B, COUP-TF-interacting protein 2, Radiation-induced tumor suppressor gene 1 protein) (MaxLight 650)

Sign In for Pricing
View Details
PARD6A Antibody, FITC conjugated
A68970-50UG 50 µg

PARD6A Antibody, FITC conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Nup53 Antibody [Alexa Fluor 532]
NB100-93322AF532 0.1 mL

Rabbit Polyclonal Nup53 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
C10orf76 Human shRNA Plasmid Kit (Locus ID 79591)
TL306300 1 Kit

C10orf76 Human shRNA Plasmid Kit (Locus ID 79591)

Sign In for Pricing
View Details