Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XII/F12, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/f12-coagulation-factor-xii-pig-p-pastoris-his.html

Smiles

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Formula

397474 (Gene_ID) O97507 (I20-R371) (Accession)

Molecular Weight

41.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CRISPLD1 Antibody [Alexa Fluor 488]
NBP2-97241AF488 0.1 mL

Rabbit Polyclonal CRISPLD1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Stangeria eriopus Cytochrome b559 subunit beta (psbF), partial
MBS7090403 Inquire

Recombinant Stangeria eriopus Cytochrome b559 subunit beta (psbF), partial

Sign In for Pricing
View Details
Sialic Acid-binding Ig-Like lectin 8 (SIGLEC8) Human ELISA Kit
H0728 96 Tests

Sialic Acid-binding Ig-Like lectin 8 (SIGLEC8) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Bordetella Avium rplA Protein (aa 1-231)
VAng-Lsx4023-50gEcoli 50 µg (E. coli)

Recombinant Bordetella Avium rplA Protein (aa 1-231)

Sign In for Pricing
View Details
Pro-Epidermal Growth Factor (EGF) Antibody (PE)
abx449828-01 10x 96 Tests

Pro-Epidermal Growth Factor (EGF) Antibody (PE)

Sign In for Pricing
View Details
Pro-Epidermal Growth Factor (EGF) Antibody (PE)
abx449828-02 5x 96 Tests

Pro-Epidermal Growth Factor (EGF) Antibody (PE)

Sign In for Pricing
View Details