Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coagulation Factor XII/F12, Pig (P. pastoris, His)

Coagulation factor XII (F12) is a serum glycoprotein that plays multiple roles in initiating blood coagulation, fibrinolysis, and the production of bradykinin and angiotensin. It is involved in these complex processes, including cleavage of prekallikrein to form kallikrein, which subsequently cleaves factor XII initially to α-factor XIIa and then, after trypsin cleavage, to β-factor XIIa. Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His) is the recombinant pig-derived F12/Coagulation Factor XII, Pig, expressed by P. pastoris , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Coagulation Factor XII/F12 Protein, Pig (P. pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/f12-coagulation-factor-xii-pig-p-pastoris-his.html

Smiles

IPPWKDPRKHKVMASEHTVVLTVTGEPCHFPFQYYRQLYYKCIQRGQRGPRPWCATTPNFEKDQRWAYCLEPMKVKDHCNKGNPCQKGGTCVNMPNGPHCICPDHFTGKHCQKEKCFEPQFLQFFQENEIWHRFEPAGVSKCQCKGPKAQCKPVASQVCSTNPCLNGGSCLQTEGHRLCRCPTGYAGRLCDVDLKERCYSDRGLSYRGMAQTTLSGAPCQPWASEATYWNMTAEQALNWGLGDHAFCRNPDNDTRPWCFVWRGDQLSWQYCRLARCQAPIGEAPPILTPTQSPSEHQDSPLLSREPQPTTQTPSQNLTSAWCAPPEQRGPLPSAGLVGCGQRLRKRLSSLNR

Molecular Formula

397474 (Gene_ID) O97507 (I20-R371) (Accession)

Molecular Weight

41.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

17β-HSD6 Double Nickase Plasmid (m)
sc-424267-NIC 20 µg

17β-HSD6 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
HADHA Rabbit Monoclonal Antibody
E56G4948 100 µL

HADHA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SCMH1 (Sex Comb on Midleg Homolog 1, Polycomb Protein SCMH1, Scml3) (MaxLight 650)
133017-ML650 100 µL

SCMH1 (Sex Comb on Midleg Homolog 1, Polycomb Protein SCMH1, Scml3) (MaxLight 650)

Sign In for Pricing
View Details
RPS3P6 CRISPR All-in-one AAV vector set (with saCas9)(Human)
42552151 3x 1.0 µg DNA

RPS3P6 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Whatman Membrane Nuclepore 0.4um 90mm PC
FIL3442 25 / PCK

Whatman Membrane Nuclepore 0.4um 90mm PC

Sign In for Pricing
View Details
B3GNTL1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV630683 1.0 µg DNA

B3GNTL1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details