Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENSA, Human (His)

ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ENSA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ensa-protein-human-his.html

Purity

95.0

Smiles

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE

Molecular Formula

2029 (Gene_ID) O43768-1 (M1-E121) (Accession)

Molecular Weight

Approximately 17 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Bacillus megaterium ATP synthase subunit c (atpE)
MBS1088992 Inquire

Recombinant Bacillus megaterium ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
VAX2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
49439111 3x 1.0 µg

VAX2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
DP2 (TFDP2) Human Over-expression Lysate
orb1339274 100 µg

DP2 (TFDP2) Human Over-expression Lysate

Sign In for Pricing
View Details
HBEGF Chemi-Luminescent ELISA Kit (Mouse)
OKCD03549-96W 96 Well

HBEGF Chemi-Luminescent ELISA Kit (Mouse)

Sign In for Pricing
View Details
NEIL1 Antibody
CSB-PA846619LA01HU-01 50 µg

NEIL1 Antibody

Sign In for Pricing
View Details
NEIL1 Antibody
CSB-PA846619LA01HU-02 100 µg

NEIL1 Antibody

Sign In for Pricing
View Details