ENSA, Human (His)
ENSA protein is a key phosphatase inhibitor that precisely controls PP2A activity during mitosis by inhibiting PP2A. Phosphorylation of Ser-67 in mitosis promotes specific interaction with PPP2R2D, leading to inactivation of PP2A. ENSA Protein, Human (His) is the recombinant human-derived ENSA protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
ENSA Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/ensa-protein-human-his.html
Purity
95.0
Smiles
MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE
Molecular Formula
2029 (Gene_ID) O43768-1 (M1-E121) (Accession)
Molecular Weight
Approximately 17 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
SERPINA6 (Serpin Peptidase Inhibitor, Clade A (alpha-1 Antiproteinase, Antitrypsin), Member 6, CBG) (HRP)
SERPINA6 (Serpin Peptidase Inhibitor, Clade A (alpha-1 Antiproteinase, Antitrypsin), Member 6, CBG) (HRP)
TRAV40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
SMAD5 (SMAD Family Member 5, DKFZp781C1895, DKFZp781O1323, Dwfc, JV5-1, MADH5) (MaxLight 405)
SMAD5 (SMAD Family Member 5, DKFZp781C1895, DKFZp781O1323, Dwfc, JV5-1, MADH5) (MaxLight 405)